Identifiers and Description

Gene Model Identifier

TTHERM_00245490

Standard Name

MRNC32 (Membrane Occupation and Recognition Nexus protein C-terminal)

Aliases

PreTt02444 | 21.m00275

Description

protein with predicted MORN domains localized at the C-terminus of the protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF02493 ) MORN repeat
  • ( PF07661 ) MORN repeat variant
  • ( TIGR01492 ) Plasmodium falciparum CPW-WPC domain
  • ( PF02189 ) Immunoreceptor tyrosine-based activation motif

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00245490

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_00595.19.997093137033517e-262hypothetical protein (965 aa)
OxytrichaContig13677.0.1.g359.001612426253082e-40MORN repeat
Stentor CoeruleusSteCoe_327137.781132241133797e-20
DictyBaseDDB_G03494880.0000000020002373268528243DDB_G0349488 on chromosome: 2
position 6912714 to 6914186
WormBaseWBGene000021790.0000004998288985444982locus:jph-1 status:Confirmed
UniProt:Q22667 protein_id
:CAA99924.2

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00245490(coding)
ATGGAAAAAGGTGAAGACAGTCGCAGGTTTAGCTTGGACTCTTTAAAAATCAAACAATTC
GATTCTGAAAAAGATGTTTATTAAAATAATGAATAGTTCACAGGAATGTATAATCACGAG
TAAGAAATGAATCAATAAATTGAACAAACAAATATGGGAGTAAATTCTTTATCACCTCAT
GAGGAATAAATTTACAGTTAATAAATGGCAAACGAAAGTAAAAATAAATAAAATTAATTT
ATCAAAGAGAATTATTAGCAAAGTTATTAGTTTGCTGAATATGGGACAAACAAATATATT
CATGGCGATAAACTCGTTATTGAATGCAACACAAATAGTGTACCAAATCCTTTATCAAAC
TCAAGCATAAATAGTCATAATAACAATCCAAACAATTAAAAAGCTGATTTTTAGGGTTAA
AATTAGAATGAAAATAATTATGCAGGAAAATCAGTAAATCATACAGATGTGCTTGAAGAA
GATGATGAAAATATTTCGTTTGGTGACCAATCGCCGCATAGAAATAAATAATAAAATTAG
TAAATGAGTAAATAGTAAAATGATTACTATAACGGTTCGAAAAACAGTTAGAATTATTAC
AATTATGGAAATTCTGATAGAATTTATTCACCATTTTAATTTAAGAATGTTTCATAAGAG
TATGATGACATGCTAGAAGATCAATAAAGAAGAGGTAGTGGAGGCATCACTTTAATAAGC
CAGTCATAACTTTATGCAAGAGATTCTATTAGGAATGTGGATAGTGTCACTGAAAGAGTG
CATGTTTCTTAAGATTAATTAGAGAATAATTAAATAAGCACATTTGACTAAGATAATAAT
AAGTAGTTCCCCTTTTTAAATAAGTAACAAGGATAGCAAAGATAATACCAAAATCAAAAT
CAGTATGAGGAATATGATAATTAATTCTAAAAGCTTATAAAAATGAGAACTTGTCCTTTA
GATGAGAAATATCCTAATAATGAAAACAAAAATAGAATGCCTCTTTATAATTACAGACTA
AGCAATGAACTAGTCGTTTCTGAATATAACAGCTAATCAGAAAACTTAGAAAGAAAGAAG
AGTAGTGACTCAGATTTATAATGTAAAAACTTACAGAATACAAATATGTAAAACTTATAC
ACTTTTAGTCCAAGAATAGAAAACAATAACTAAAATAAGACTCAGAAACAAATGAAAGAA
GGGAATTAAAATGGACAGGTGGTTAATGAGAATAAAAGCAATAAGAAATTAAATTTAGAT
AAAACACAAGATAAAGATAATAAGAGCTAAGTTTAGTAACAAAGAGATCAAAAGATAAAT
TAATAAAAAAGAAAGGAATAAATTGATCAAATAGATGAAACAGATAAATAAGATATTTTA
AATGATATATAAATTAAATGTTAGATAAAAGAACATGATGGAGAAAAGATTATTATGGTT
TGTGTGGATCCTTACTGTGAGGCATAGTATAGATTATGCTGTGGCTTTTGCAATAAATTG
CATTCTAAACATATACATTAGCTAATGAGGCTGTAGGAATATAGGTATAAGATTTTGCAA
TCTAGCAAGATTCTTGGAAAATCAGAGTAAGAACAAGATAAAAAAGAGAAAGATGCTAAC
AAAATTAATCACAAGGAATTATTGTATTTGTGTATGCAAAGATAGAACTAGCTTTATTAA
GAGATCAAAAAACATTTGGATAGCACTTTCCTACAAATTCAAAAGCTTGTTGAAGATAAA
GAGAAGAATATACTTTCATATATTTCTTCTTATGATGAAGAATACAATTATTACTTAGAA
AAGCTATAAAAATTACAATAAAAAGATTATTTTTCACTAACAAATAAAGATTTTTTAAAG
TTATTTAATTTCTAGAAATCGCCTGAAAAGTTTCTTGAACATCAAACTATAAATGATAAT
TGTAGGAAAAAGTAATTATCAGAATTAGATGATATAGTTTATGATTATTATGTTGATTTG
TAAGATATTTTTAAAGACTGTTTAGAGTAATCTAATAATCTCTTGTATGATCTACTTTTA
AAGTTGACTTCCAACAATATTGTTGCTACCCAAGCTAGATCAACTACGCCTTAAAATGTG
TCAAGTAGAAAAGTAAACCAATTCAGTACTCCTGATAAAAAAGGTACTTAGGAATAAACA
ACATCTGCTAATAGAAATTCTTAATCTCCCTTACAAAAATTCATTAATAGGACAGCAAAA
AGTTTATTAGTCATTAACAGTAACAATAACCACATGGTTGAAAAAGGTATTCCTGGTCAT
AAAAGATTAGAAGAGTTACCTCAATGGTGCTCTTAAATGCAGCATGTTACCAGAGCATTA
AAAAAATTTGGTCCATACAAATTTGAAAATGTCAAACCTAAATCAATAAATTTGGGAATG
CAGCAAAACATCAAATCAGAAAATGTTTACATAGGTGACTGGGTAAATTTTATGAGGGAA
GGAAATGGAATTGAATATTCTAAAAAAGACTAAACCTACTACGAAGGACAATGGAAATCT
AATTTAAAGCATGGAAATGGTCGATTAGTTTGTAGGAATGACATAGTGTATGAAGGCTAG
TTCGAAGGTAATAAAAAGTAAGGTTATGGGGTTCTTTATTAGTTTGGAGGAAAAAGATAT
GAAGGTTAGTGGAGCAATGATTTACCTAATGGTAATGGCATTTAATATTATCCTAATGGG
GATATATTTGAAGGAGAGTTTTAAAACGGTGTTAAGTAAGGAAGTGGAACATTTAAATAT
TTTGATGGTTCTACTTTATCAGGTAGCTGGGTAAAAGATCAAGCAAATGGTGCTTGCACA
TATTTCAAAATAGATGGCTCAAAATACGAAGGTGAATATAAAAATGGTAAAAAGCATGGT
TTTGGAACATTTATATGGAGTGATGGAAGAAAATATGTAGGACATTGGGAAAATGGTGTA
TAAGATGGTGCAGGCTTGTACACTAACTCTAAAGGCATAACTGTTCAAGGAATTTGGAAG
AATGGTAAAAAAATTCAATAAAATGATTCAGATTTTAATAAATTTATTGTTAGATGA


>TTHERM_00245490(protein)
MEKGEDSRRFSLDSLKIKQFDSEKDVYQNNEQFTGMYNHEQEMNQQIEQTNMGVNSLSPH
EEQIYSQQMANESKNKQNQFIKENYQQSYQFAEYGTNKYIHGDKLVIECNTNSVPNPLSN
SSINSHNNNPNNQKADFQGQNQNENNYAGKSVNHTDVLEEDDENISFGDQSPHRNKQQNQ
QMSKQQNDYYNGSKNSQNYYNYGNSDRIYSPFQFKNVSQEYDDMLEDQQRRGSGGITLIS
QSQLYARDSIRNVDSVTERVHVSQDQLENNQISTFDQDNNKQFPFLNKQQGQQRQYQNQN
QYEEYDNQFQKLIKMRTCPLDEKYPNNENKNRMPLYNYRLSNELVVSEYNSQSENLERKK
SSDSDLQCKNLQNTNMQNLYTFSPRIENNNQNKTQKQMKEGNQNGQVVNENKSNKKLNLD
KTQDKDNKSQVQQQRDQKINQQKRKEQIDQIDETDKQDILNDIQIKCQIKEHDGEKIIMV
CVDPYCEAQYRLCCGFCNKLHSKHIHQLMRLQEYRYKILQSSKILGKSEQEQDKKEKDAN
KINHKELLYLCMQRQNQLYQEIKKHLDSTFLQIQKLVEDKEKNILSYISSYDEEYNYYLE
KLQKLQQKDYFSLTNKDFLKLFNFQKSPEKFLEHQTINDNCRKKQLSELDDIVYDYYVDL
QDIFKDCLEQSNNLLYDLLLKLTSNNIVATQARSTTPQNVSSRKVNQFSTPDKKGTQEQT
TSANRNSQSPLQKFINRTAKSLLVINSNNNHMVEKGIPGHKRLEELPQWCSQMQHVTRAL
KKFGPYKFENVKPKSINLGMQQNIKSENVYIGDWVNFMREGNGIEYSKKDQTYYEGQWKS
NLKHGNGRLVCRNDIVYEGQFEGNKKQGYGVLYQFGGKRYEGQWSNDLPNGNGIQYYPNG
DIFEGEFQNGVKQGSGTFKYFDGSTLSGSWVKDQANGACTYFKIDGSKYEGEYKNGKKHG
FGTFIWSDGRKYVGHWENGVQDGAGLYTNSKGITVQGIWKNGKKIQQNDSDFNKFIVR


>TTHERM_00245490(gene)
TAAAAGAACCAAATTGAAAAGAGATAAATGGAAAAAGGTGAAGACAGTCGCAGGTTTAGC
TTGGACTCTTTAAAAATCAAACAATTCGATTCTGAAAAAGATGTTTATTAAAATAATGAA
TAGTTCACAGGAATGTATAATCACGAGTAAGAAATGAATCAATAAATTGAACAAACAAAT
ATGGGAGTAAATTCTTTATCACCTCATGAGGAATAAATTTACAGTTAATAAATGGCAAAC
GAAAGTAAAAATAAATAAAATTAATTTATCAAAGAGAATTATTAGCAAAGTTATTAGTTT
GCTGAATATGGGACAAACAAATATATTCATGGCGATAAACTCGTTATTGAATGCAACACA
AATAGTGTACCAAATCCTTTATCAAACTCAAGCATAAATAGTCATAATAACAATCCAAAC
AATTAAAAAGCTGATTTTTAGGGTTAAAATTAGAATGAAAATAATTATGCAGGAAAATCA
GTAAATCATACAGATGTGCTTGAAGAAGATGATGAAAATATTTCGTTTGGTGACCAATCG
CCGCATAGAAATAAATAATAAAATTAGTAAATGAGTAAATAGTAAAATGATTACTATAAC
GGTTCGAAAAACAGTTAGAATTATTACAATTATGGAAATTCTGATAGAATTTATTCACCA
TTTTAATTTAAGAATGTTTCATAAGAGTATGATGACATGCTAGAAGATCAATAAAGAAGA
GGTAGTGGAGGCATCACTTTAATAAGCCAGTCATAACTTTATGCAAGAGATTCTATTAGG
AATGTGGATAGTGTCACTGAAAGAGTGCATGTTTCTTAAGATTAATTAGAGAATAATTAA
ATAAGCACATTTGACTAAGATAATAATAAGTAGTTCCCCTTTTTAAATAAGTAACAAGGA
TAGCAAAGATAATACCAAAATCAAAATCAGTATGAGGAATATGATAATTAATTCTAAAAG
CTTATAAAAATGAGAACTTGTCCTTTAGATGAGAAATATCCTAATAATGAAAACAAAAAT
AGAATGCCTCTTTATAATTACAGACTAAGCAATGAACTAGTCGTTTCTGAATATAACAGC
TAATCAGAAAACTTAGAAAGAAAGAAGAGTAGTGACTCAGATTTATAATGTAAAAACTTA
CAGAATACAAATATGTAAAACTTATACACTTTTAGTCCAAGAATAGAAAACAATAACTAA
AATAAGACTCAGAAACAAATGAAAGAAGGGAATTAAAATGGACAGGTGGTTAATGAGAAT
AAAAGCAATAAGAAATTAAATTTAGATAAAACACAAGATAAAGATAATAAGAGCTAAGTT
TAGTAACAAAGAGATCAAAAGATAAATTAATAAAAAAGAAAGGAATAAATTGATCAAATA
GATGAAACAGATAAATAAGATATTTTAAATGATATATAAATTAAATGTTAGATAAAAGAA
CATGATGGAGAAAAGATTATTATGGTTTGTGTGGATCCTTACTGTGAGGCATAGTATAGA
TTATGCTGTGGCTTTTGCAATAAATTGCATTCTAAACATATACATTAGCTAATGAGGCTG
TAGGAATATAGGTATAAGATTTTGCAATCTAGCAAGATTCTTGGAAAATCAGAGTAAGAA
CAAGATAAAAAAGAGAAAGATGCTAACAAAATTAATCACAAGGAATTATTGTATTTGTGT
ATGCAAAGATAGAACTAGCTTTATTAAGAGATCAAAAAACATTTGGATAGCACTTTCCTA
CAAATTCAAAAGCTTGTTGAAGATAAAGAGAAGAATATACTTTCATATATTTCTTCTTAT
GATGAAGAATACAATTATTACTTAGAAAAGCTATAAAAATTACAATAAAAAGATTATTTT
TCACTAACAAATAAAGATTTTTTAAAGTTATTTAATTTCTAGAAATCGCCTGAAAAGTTT
CTTGAACATCAAACTATAAATGATAATTGTAGGAAAAAGTAATTATCAGAATTAGATGAT
ATAGTTTATGATTATTATGTTGATTTGTAAGATATTTTTAAAGACTGTTTAGAGTAATCT
AATAATCTCTTGTATGATCTACTTTTAAAGTTGACTTCCAACAATATTGTTGCTACCCAA
GCTAGATCAACTACGCCTTAAAATGTGTCAAGTAGAAAAGTAAACCAATTCAGTACTCCT
GATAAAAAAGGTACTTAGGAATAAACAACATCTGCTAATAGAAATTCTTAATCTCCCTTA
CAAAAATTCATTAATAGGACAGCAAAAAGTTTATTAGTCATTAACAGTAACAATAACCAC
ATGGTTGAAAAAGGTATTCCTGGTCATAAAAGATTAGAAGAGTTACCTCAATGGTGCTCT
TAAATGCAGCATGTTACCAGAGCATTAAAAAAATTTGGTCCATACAAATTTGAAAATGTC
AAACCTAAATCAATAAATTTGGGAATGCAGCAAAACATCAAATCAGAAAATGTTTACATA
GGTGACTGGGTAAATTTTATGAGGGAAGGAAATGGAATTGAATATTCTAAAAAAGACTAA
ACCTACTACGAAGGACAATGGAAATCTAATTTAAAGCATGGAAATGGTCGATTAGTTTGT
AGGAATGACATAGTGTAATAATTTCATTCATTCATATTATCATATTCATTTAATATTTTG
TTAAAGTAAGTAACAAACCAAAAAGTAGATTATTTGAATTCAATTTGAATGCTATTAAGA
AATTAATAAGTCTACATATAATTTTTTTCTTTTTCATATTTAATGGTCAAGTTTAAATTT
TGTAATTTCAGTCTATTCTAATTGATAAAAATTGAAATTTAAATTTCAGTTAAAATAAGA
AAATGTAGAAAAAAATACAATTTCTGTAATTTGTTTAATATAAAAAGGTATGAAGGCTAG
TTCGAAGGTAATAAAAAGTAAGGTTATGGGGTTCTTTATTAGTTTGGAGGAAAAAGATAT
GAAGGTATCAATAAAAATATTTTTTTTCTTAATAATTAGCTTTAAATTCTGAAAATAAAG
GTTAGTGGAGCAATGATTTACCTAATGGTAATGGCATTTAATATTATCCTAATGGGGATA
TATTTGAAGGAGAGTTTTAAAACGGTGTTAAGTAAGGAAGTGGAACATTTAAATATTTTG
ATGGTTCTACTTTATCAGGTAGCTGGGTAAAAGATCAAGCAAATGGTGCTTGCACATATT
TCAAAATAGATGGCTCAAAATACGAAGGTGAATATAAAAATGGTAAAAAGCATGGTTTTG
GAACATTTATATGGAGTGATGGAAGAAAATATGTAGGACATTGGGAAAATGGTGTATAAG
ATGGTGCAGGCTTGTACACTAACTCTAAAGGCATAACTGTTCAAGGAATTTGGAAGAATG
GTAAAAAAATTCAATAAAATGATTCAGATTTTAATAAATTTATTGTTAGATGA