Identifiers and Description

Gene Model Identifier

TTHERM_00486410

Standard Name

MRNC30 (Membrane Occupation and Recognition Nexus protein C-terminal)

Aliases

PreTt19572 | 59.m00210 | 3680.m00067

Description

protein with predicted MORN domains localized at the C-terminus of the protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 41.9%

TetraMine Data

TTHERM_00486410

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_12140.19.997093137033517e-262hypothetical protein (449 aa)
OxytrichaContig7961.0.g388.999890565246037e-26MORN repeat
WormBaseWBGene000021790.000000000029994712494008525locus:jph-1 status:Confirmed
UniProt:Q22667 protein_id
:CAA99924.2
Stentor CoeruleusSteCoe_61390.00000000003775134544279098
DictyBaseDDB_G02882270.0000000020002373268528243DDB_G0288227 on chromosome: 5
position 1280700 to 1282179

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00486410(coding)
ATGTTTTTATTATTTTTAAAATAAATTTAATAAGTTGGTTTTATTTTTTTGGTTTGCCTG
AAAACAAAAAATTAGTTAATAAATTTAAGTTTTCTGTTATAAAATATGAAGGGAAAATAG
CAGAAAGAAGCAGAAGTTTTTTTTACTGAAAAAATAAAGCAAAACCATGAAAATGTAAAC
TCAACACTTTGTTAATACTTGTCAGAAATCAAATAAAATTTAATAGTTTATCTTTTGTGG
ATAATAAAATATCATAAATTATCATAAGAATAATTTTTCTTTTAATAATTTGTTATTATT
ATTATTAATAAATTAATATTTGATTTTATAAAGCACCAAAAAATTAGCATGGACGATACT
GAATAAAAGCTAACAGAATTTTTCAAAAATAAGCATTGCATATGGCATACAAAGAAAAGA
CCAACTTTAGTTTGTTTAGATTATTTTTGTGAAAATAAAGGACTTATATGTGCAAGCTGC
TTAACTATAAAAGGAAATCATAAAGGACATGACAGTTTAGAACTAGGTGAATTTTTAGAT
TAGATTAATGATAAATTTTCTTCTGCTGCAGAAATGGATAAAAAATTTTAATAGGAAAGT
GACTTTCATTTAAAATAGAATATTGATTCAATTCGGTCATTTTAAAAGAAATTAAATGAC
TTGATTGATTCGTATGTTGAGCAAAGGGTAAAAAGACACTAGGCTAAAATGAATGAGTTG
AATACAAGCCAACTAATTCAAAAATGCAAACAAGCAGATTTTAAGACACTAGAAGAGTTT
AATTCTGCAATTAAGCATCTTAGCACCAAGCTAAAGTACAAAAACGATTCATCTCTGCAA
AGTATTGAAGCAGACTCATCTAACTAAACAATAGAATAATAATTGCAATAGGTTTATTTG
GAAGATTTCGATGCACATATGCAGATTATTGAAAAATATTTAAATAAAGATATTCTTCCC
TACCTCGAATAAAAGGTTTTCAATTTAGATTGCTTGCGCTCTCCGAAGTATTATTTCTAA
CCATTTTATTTGCAGGAAAGTAATTTATCTATAGAAATGCTGAATAATAATAAAACAAAT
GATGGAAAGTCTACTTACAAAGGATTCTATGAAAACTAAGAAATAATTTATATAGGTGAA
CTTTAAGCCACTTTACCACATGGAAAGGGACTTTGCTATTTTAGACATACAGGTAAAATA
TATGAGGGAGAATTCCTGCAAGGAAAACTTCATGGTAAAGGCAGAATAATATTTTAAAAT
GGCGATACTTATATTGGCGATTTTCATTTAGATAAAAAGTAAGGAAGAGGAATTTATGTA
TGGACTTAGAAAGGTAATTATTACGAAGGAGAATTCTGGAATTCAAAAAGGCATGGACAG
GGATTATTTATCAGCTCTGATGGTAGCTAATATGAAGGTAACTTTAAAGATGGTGTTTAA
AGTGGTTATGGTACACTTAAAAAGAAAAATGGAGAAATAGAATATGAAGGGTAGTGGAGC
AATGGTTGCTTTGAAGGAAAAGGAATACAGTATTTAGAAAATGGTGATAAGTATAACGGT
GAATTTTCCTAAGATATGTTTAATGGACGTGGAGTTTATACTAAAAAAATAGATAATACA
GAAATTCATGGAATATGGAAAAACAACCAGCTTGTAGTAGTTAATTAGACAATATCTAGA
AACTAACAAGAAAATTGA


>TTHERM_00486410(protein)
MFLLFLKQIQQVGFIFLVCLKTKNQLINLSFLLQNMKGKQQKEAEVFFTEKIKQNHENVN
STLCQYLSEIKQNLIVYLLWIIKYHKLSQEQFFFQQFVIIIINKLIFDFIKHQKISMDDT
EQKLTEFFKNKHCIWHTKKRPTLVCLDYFCENKGLICASCLTIKGNHKGHDSLELGEFLD
QINDKFSSAAEMDKKFQQESDFHLKQNIDSIRSFQKKLNDLIDSYVEQRVKRHQAKMNEL
NTSQLIQKCKQADFKTLEEFNSAIKHLSTKLKYKNDSSLQSIEADSSNQTIEQQLQQVYL
EDFDAHMQIIEKYLNKDILPYLEQKVFNLDCLRSPKYYFQPFYLQESNLSIEMLNNNKTN
DGKSTYKGFYENQEIIYIGELQATLPHGKGLCYFRHTGKIYEGEFLQGKLHGKGRIIFQN
GDTYIGDFHLDKKQGRGIYVWTQKGNYYEGEFWNSKRHGQGLFISSDGSQYEGNFKDGVQ
SGYGTLKKKNGEIEYEGQWSNGCFEGKGIQYLENGDKYNGEFSQDMFNGRGVYTKKIDNT
EIHGIWKNNQLVVVNQTISRNQQEN


>TTHERM_00486410(gene)
ATGTTTTTATTATTTTTAAAATAAATTTAATAAGTTGGTTTTATTTTTTTGGTTTGCCTG
AAAACAAAAAATTAGTTAATAAATTTAAGTTTTCTGTTATAAAATATGAAGGGAAAATAG
CAGAAAGAAGCAGAAGTTTTTTTTACTGAAAAAATAAAGCAAAACCATGAAAATGTAAAC
TCAACACTTTGTTAATACTTGTCAGAAATCAAATAAAATTTAATAGTTTATCTTTTGTGG
ATAATAAAATATCATAAATTATCATAAGAATAATTTTTCTTTTAATAATTTGTTATTATT
ATTATTAATAAATTAATATTTGATTTTATAAAGCACCAAAAAATTAGCATGGACGATACT
GAATAAAAGCTAACAGAATTTTTCAAAAATAAGCATTGCATATGGCATACAAAGAAAAGA
CCAACTTTAGTTTGTTTAGATTATTTTTGTGAAAATAAAGGACTTATATGTGCAAGCTGC
TTAACTATAAAAGGAAATCATAAAGGACATGACAGTTTAGAACTAGGTGAATTTTTAGAT
TAGATTAATGATAAATTTTCTTCTGCTGCAGAAATGGATAAAAAATTTTAATAGGAAAGT
GACTTTCATTTAAAATAGAATATTGATTCAATTCGGTCATTTTAAAAGAAATTAAATGAC
TTGATTGATTCGTATGTTGAGCAAAGGGTAAAAAGACACTAGGCTAAAATGAATGAGTTG
AATACAAGCCAACTAATTCAAAAATGCAAACAAGCAGATTTTAAGACACTAGAAGAGTTT
AATTCTGCAATTAAGCATCTTAGCACCAAGCTAAAGTACAAAAACGATTCATCTCTGCAA
AGTATTGAAGCAGACTCATCTAACTAAACAATAGAATAATAATTGCAATAGGTTTATTTG
GAAGATTTCGATGCACATATGCAGATTATTGAAAAATATTTAAATAAAGATATTCTTCCC
TACCTCGAATAAAAGGTTTTCAATTTAGATTGCTTGCGCTCTCCGAAGTATTATTTCTAA
CCATTTTATTTGCAGGAAAGTAATTTATCTATAGAAATGCTGAATAATAATAAAACAAAT
GATGGAAAGTCTACTTACAAAGGATTCTATGAAAACTAAGAAATAATTTATATAGGTGAA
CTTTAAGCCACTTTACCACATGGAAAGGGACTTTGCTATTTTAGACATACAGGTAAAATA
TATGAGGGAGAATTCCTGCAAGGAAAACTTCATGGTAAAGGCAGAATAATATTTTAAAAT
GGCGATACTTATATTGGCGATTTTCATTTAGATAAAAAGTAAGGAAGAGGAATTTATGTA
TGGACTTAGAAAGGTATTTATTTATTAATTAATTAATTTAACTTCTCTTTTTTAATTGAT
CTTCTAAAGATTTTTTAAATTTGATGAAATTTCAAATATTTATTTATTATTTAACGATGA
AAGGTAATTATTACGAAGGAGAATTCTGGAATTCAAAAAGGCATGGACAGGGATTATTTA
TCAGCTCTGATGGTAGCTAATATGAAGGTAACTTTAAAGATGGTGTTTAAAGTGGTTATG
GTACACTTAAAAAGAAAAATGGAGAAATAGAATATGAAGGGTAGTGGAGCAATGGTTGCT
TTGAAGGAAAAGGAATACAGTATTTAGAAAATGGTGATAAGTATAACGGTGAATTTTCCT
AAGATATGTTTAATGGACGTGGAGTTTATACTAAAAAAATAGATAATACAGAAATTCATG
GAATATGGAAAAACAACCAGCTTGTAGTAGTTAATTAGACAATATCTAGAAACTAACAAG
AAAATTGA