Identifiers and Description

Gene Model Identifier

TTHERM_00127110

Standard Name

MRNC29 (Membrane Occupation and Recognition Nexus protein C-terminal)

Aliases

PreTt09374 | 9.m00395 | 3699.m00104

Description

protein with predicted MORN domains localized at the C-terminus of the protein. Viral A-type inclusion protein repeat containing protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Biological Process

Domains

  • ( PF02524 ) KID repeat
  • ( PF06994 ) Involucrin
  • ( PF01576 ) Myosin tail
  • ( PF02493 ) MORN repeat
  • ( PF08581 ) Tup N-terminal
  • ( PF00435 ) Spectrin repeat
  • ( PF02370 ) M protein repeat
  • ( PF08178 ) GnsA/GnsB family
  • ( PF00904 ) Involucrin repeat
  • ( PF01920 ) Prefoldin subunit
  • ( TIGR01612 ) rhoptry protein
  • ( PF07661 ) MORN repeat variant
  • ( PF07926 ) TPR/MLP1/MLP2-like protein
  • ( PF08580 ) Yeast cortical protein KAR9
  • ( PF00038 ) Intermediate filament protein
  • ( TIGR02559 ) type III secretion protein HrpB7
  • ( PF04394 ) Protein of unknown function, DUF536
  • ( PF08946 ) Osmosensory transporter coiled coil
  • ( TIGR00864 ) polycystin cation channel protein
  • ( PF06696 ) Streptococcal surface antigen repeat
  • ( PF04508 ) Viral A-type inclusion protein repeat
  • ( TIGR00741 ) ribosomal subunit interface protein
  • ( PF02403 ) Seryl-tRNA synthetase N-terminal domain
  • ( TIGR00100 ) hydrogenase nickel insertion protein HypA

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.5%

TetraMine Data

TTHERM_00127110

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Stentor CoeruleusSteCoe_288840
Tetrahymena borealisEI9_10689.15.999140071902665e-66hypothetical protein (2229 aa)

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00127110(coding)
ATGAACGATAGCGACCTATACTAAGATAGCAGCTAAGAAGGTTCATCAAGAAAGGAAGAT
CAAAATCATAAAAATCCACTTTTTGATGAAATCTAAGCAGATGGCGATGCTGCAGATTTT
GATTTAGACTCTCACAATGAATCTAAAAGCGCATAGAAAAACTACGACTTAGAAGACTCA
CCCTAAGGACCTACTCAAGAGCAAATAAGTCCTAACAAGGATCAATATAGTGACCAATAA
GAATTAGATGAAGTTAATCAAGTCCAAGAAAAGTCTGTAGAAAAAAATGATAACTTCGAA
AGCAGTGATTTCAAAAAGTATCTCAATAACGATGAAAATGAAAATTATAAATATTTTGAA
GAGTAGCAAGAAGAAGAGGAAGAAGAAAGATAGAATGAAAGTTCATAAGGAGAACAAGTA
AGAGAAGAAGCTTTACAATACTAGCAAAAGAATAGTCTTTTTGATGATTTGCAAGGAGAA
GCAGACTTTGATATCAATTAAAGTTCATCAAGAAAAGATACTTAAAATAGCGAGAGACTT
TATTCTTAAGGAGACGAAGATTTTGTTTAACAAAATACTTAAAAGCATCAATAAGAGAAT
GAAAGTATATTTTATAAGTAAAGAAATCAACCAGATGATTAGTAGAGTTAGGAGCAAGAA
TAAAAGCAATAAGATGAAATTATTGCTTTTAACTAAGAAGAAAATGTAGATAATCAAAAC
AAAGAATAAGATGCTGATAATGAAAAAGTAAAAGAGAGTGAAGAAGGAGACAGTCTTTCA
AATAACAATGAAAAAACAAATTTTGAAGCATAAATATAATAATAAGTTGATCAAGGAGAT
GATTAGCATTTGATTAAGCTGCTCAATCCTTCTGAAGAAGTAGAAGCCTCAATCAAAAAC
AACTCAAACTTGCATGAAGAAAATTTATAGTAAAGTGATTAAAAAGATTAGTAGGTTAAG
GGAGAAGATATCTATCAAGGAAATGAAGAAGAAATGAGTAACCAAGATTAAAATTAGGAA
GAAGCAAATGATTAATTAGAAAATGATTCAAATATTTAAGAAAATAAAAGTATAAAGCAA
GACTAAGAAGAAATTAAAACTCCAATCAAATAATAAGAAGAAGAAAGTTAGCAAGATATT
TAAACAGAAATTTAAGTTGAATAAGAAAATCACATGGAAAAACAAGGACAATAACAAGTA
GAAGTTGATAATAAGAATGAAAATTCAAATTTAGAAGAAGTTTCTAATTAAGAAGAGTAA
AGTTTAAGAGAGTAGCAAATAAATGATGAGATAAATTAGCTAGAAGATGATAAGCACAGT
GAATAAAAGTAATTTGATTAAGATTAATAAAGCAGAGAAGAAAATATCTAATCAGAGGTA
TTCAAGTAAGATAGAGATAATCATTAATAAAATGAAGCTTAGCAATATTAATAAGAAGAA
GAAGAAGAATAAGAAAGTTTGAAGCAGGAAGAATATCCTAGCGAATTAAAATAATCTATG
AATGATAGCGAATTATATAGAAATAGCAGCTTTGAAAACTCTTAATTTAACTAGTATCAA
AAAGATAATTTACATAATTAAGAGGAAGAGCAGCAATCTCCTAAGATAGGATCATCAAGT
GTTTTGAATAATTATAAACTTGAAGACTCTCCTTCAAGACCTGCTGCAGCTGGGGATTCT
AGGAAATAATCTGATAACTATGAATAAGACTTGTATTACAAGGATCATATTTAAGAATTA
CATAATTAGTAAGAATATAAAAGTGAGTATTAGCCTTCTCCTCAAAAAGAAGACTATGAC
GATCTTGAATCAGATGGATTCGATACTCTTAAAATGAATGCTAATGATTAAAATGATCAA
TCTTCTCATAAATATGGAATTCAAGTCCACATTGAAAAATCATTAGCACCTGAATAGGCA
GTTGACGAAAATAATCTTGAAAACAATTTGTTAAATCCTATTGAGAAAAAATAATAAATT
ATGAGTTTGGGAGATAGCGCATTAAAGGATATTTTAAATGAAATAAAAACATTCAAACAA
GAGAAGTAACAAAAAGACCCTGAGGAAATAGTAATGAGACTTAGCACTTTATTGTAAGAA
TTAGAGGTCTAAAACTTAAATAATTCTTTAAAGCTTTCTTAAAACTAAATTCCTAACGAT
TCTTAAATAGAAAAAGATTTTGAGTAAAAGATTTAAGCCAGTCTTTAAAAAGAGAGCCTT
AAGAAAGAAGAAAAGTAGAATTCTGAAGCTTAAAAGGATGAGGTCACTGAGTTCAATCAA
GAAGATAAAATTGATAAGGAAGAATTTCAAAAAGAAAAAGAAATTATCACAAAAGAAAAG
GAAGAATTAATTCAGTTAAAAGAAGATCTCAGAAAGTAGAAAGAAGATTTCAACAAATAA
AAATAAGAGGTTGAAAAATAAAAGAGTGAATTAGAATTGAAGGCAGAAAATTTAAATTTA
ATTTCAATGTAATTTGAAGAAAGAGAAAAGGAGCTCGAAGAAGTATAAAACACGTTATAA
TAGTAATAAGAAGAGTTAAGCTAAAAGCGCAAATAATACGAACAAATTTAAGATAAATTA
GAGTTGTTAGAGTAAAAAGAGCAGCATGTTAAAGAAAGAGAAGAAACTTTAGCTTAATAA
ATTGAATTCCTTAAAGAAAAAGACATTTATGTAAATGACAGAGAATAAGAATTATTAGAT
AAAGAAAGGGAATTAGAGTCATTGTTTGAAGAATAAAAAGAGAAGGAGAAATATTTAGAG
AATTTAATTAATGAATAAAATCAAAAATTAAAACTTTTAGAGCAACAATCAATTAATCAA
TAAAGCGAAGATTTGAAACTTTTAGAGCAACAATTTATTAATGAATAAAATGAAAAATTG
AAACTTTTAGAGCAACAATTAATTAATGAATAAAATGAAAAATTGAAAAATTTAGAAGAA
AAATTAGTTAATGAATAAAATGAAAAGTTGAAACTTTTAGAGCAACAATTAGATGAACAT
TAAGCAAAAGAAAAGGCTTTGGAGTAATTGCTAAAAGAAAATGATGGTAAATAAAAGGAG
CTAGATTTGCTTATAAGTTAGTAAGCAGAGAAAGAGTAGGTCTTATAATAATTGATGGAG
TAATAGAAGTAGAGAGAATATGAATTCGAGCAAATTGTTAATGAATAAAAATAAAAAGAA
TAGGAGCTTGAATAACTATTCAGTGAATAATCTAAGATCAAGCATCAACTTGAGTAATAA
TTAGCTTAATAAATAGAAAAAGAATAAGAACTTGATTAGTTAATTAATGAAGCTTAGTCT
AGAAACCAAGCAACTTTTACAGAAGAATAAGAAATCGTATTAACCACACCAAAGAAAGAA
GAAAGACAAGAAAGAACTGTTTAAGAAGGTAGAAATGAAGACTTTACTGAAGGAAATGAT
GAAAATGAAGAGGAATTAGAATTACGTTTAAAAAAAGAGGTTGAGGATCTTTAACAATAA
CTTTAGATAAGTGCTTAGAAAAACCAAGAATCTGCTAAGAAAATCATAGACCTTGAAAAG
GCTGTATAAAATTACTAAATGATTGAAAGAGATGAAAAAAATTTTGAAGAAATCTTTAGG
TAAAACAAAAAACTTGAAGATAAAATTAAATCATATGAAATGGAATATTCAGCTAGAAAG
AATTAGCTAGAGCATTAGGAATAAACTATTGCTAAATTGCATTCCTAGCTTGTTTAGGCT
GATGCAGATCTATAAAAATATATAGAAGATAAACGATTACTTAATGACAAAATCGAAGCT
TTAAAATATGAAAAGGAAGAAGAAATAAAAAGACTAAAGTAAGAAAATGATATTGAAAAA
ATGAGCAGAAGTCAAAGTAAATTAATGGAAAGTGAAAGTATTGCTTTTGAATCAATTGTT
GGTGATTATAAGGATACTATCAACATGCTCAGCAATAAGTGTGAGGATTACGAAACTCAA
ATACAAAATTTAACAAAGCAAAACAATGTTCTTGTTAATTCGTTTAAAGAAATCAAGTCA
AACTTAACCTCTTACTAAGAAGAGCTAGATAACAAAGAGGAATTTATCTAAAAGTAATCT
TAAGATATGTTTGAATTATAAAAGAGTGTTAATCAATATAAGCAAATGGCAAAGAAGTTA
GAGGATTAGTTGAAAGATTTGTCTAACAAATCTTAAGAAGAATCTAGCACTCTTTAATAT
GAATTAGAAAAAAACAACATATTGCTAGAATAAAAAAATAAAGATGTGCAAGCTAAAAAT
TAAGAAATTTAAAGTTTGTATGAAAAAATCTCATTGATTGAAAAATCAAATTTATAGAAA
TTAGAGGATCTCAATCTTGTCATTCAAGAAGAGCAAAATTAGAGAAAAGAAATATAAACA
GAACTTGAATAGTTGGTTGATAAATATAATTAAGATGTTTAGGAATTACAAAAGGTAATG
GATTAATAATAGGAAGAATTTACTCAAATTTAATAACAATTGTAAGAATCAAGTTAGAAT
TAATAGAAAGAAAACTTAAACTTAAAAGAATAAATGGAACATCTCAAATAATAATTAGAT
TAAAAAAATGCAGAAATTGTTTCTAAACAAGAAGAGTTGTTGAATCTTGAAGATATGTTA
CAAAAAATTGAAAATGATTTAAAATAACAAAAGCATGAATTTGATTTGTAAATTTAAAAA
TAAGAAGATAGCAATAACTAACATGTTGACTAATTGTAAAAGATAATTGATGAAAAACAA
GAAGAAATTAGTTTATTATAATAAAATTAATAAGATAGCAGTTTGAGATCTTAAGAAGAC
TTAAAGATTTTAAAGATCAAATTAGACAATTTAGTTTCTGAATTGAATAATGCAAATGAA
TAACTGAATGAAATGGATAAAGAATTACAGTTTAAAGATGAATAACTTAAATTAACTGAG
AAAGAATATTAAATGAATATTAATTAATTACAAGTTAAGCAAAATGACTTACAAGATCAA
AAAAAATAATTAGAAGAAATGCTATAGGAATAAGAGGAAAGATATAGCCAAGAAATAACT
TAATTGTAAAACATAATTGATTAATAATAAGAAGATCTTTAAGGCTTGTAATAGAATTTG
TTAGGAAGCTCAAAAATCTAAGAAGATAAAAACAAAGCTTTAACTAATGAATTATAATAG
GCTAAGCAAGAGATTGAAAAAATGAATCATTAATTATAGGCTTAACACAAAGATTTAGAA
AAGGCTTACTAGTAATTTGATGATAGCGAAAAGCAAAATTAACAAAAATTAAAGTCCGCA
GAAGTTAAATTGCAGGATTTAGAGGCTAAATACAAAGATTTATAAGAATCTATATAAATT
GAGTAAGAAAAATATAGTAAAGATATTGAAGAGCTTCAGAATATTATTGAGACTTAATAG
CAAGAGATTAACTTAATGGAGTAAAATATGACAAAGCTGAAAAATGATTTAGACAGAAAG
GTCAAAGATTTAGATGTTAAAAATATTGAAATTCAAGCAAAAGATAGTGATTTGGAAAGT
GCTTATGCTTAAATTGATAAAATTGATATATAGTATCAACATAAGCTTAATGAATATGAA
TCTAAATAGTAAGAACTTGCAAATAATAACAATCATTTAGAAGGAAAGTTAATTGAGCTA
GAAGATAAATATAATAAAGATGTTTCAGAACTTTAAAAAGTTATTGAATAATAATAATAA
GACTTGAATAATTTGGAATAAGAATTATACAATCAAGGTAGTCAAAACGAAGAGACTAGT
AATCTTAGAGTTGAGTTAGAAAAGGTTTCTATTTAATTAGATGAAAGGAACAGTGAAATA
TTAATAAAGAACAAAGAGCTAGATAGCATGTATGAATAAATTGATAAAATCGAGAGATAG
TATCAACAAAAGCTTAGAGAGCAAGAAATCAAAATACAAGATCTCTAAAAACTAAAAAAA
GAGTATGATTAGTAATTGTTAGAGTTAGATAATAAAAATAGCTAAGACATTGCCGATTTA
AAGAATATTATTGAGTAGTAATAAGAGGATTTGAATAATATGCAAAAAGATTTATTTGAG
AACACTAAACATTAAGAAGAGAACAATAACTTAAGATTTGAATTGGAAAGAAAGAATATT
CAACTTAACAGTGACCTCATTTAAAAAAATAAAGAGTTGGATTAATTGCATGAGTAGATA
AATAAGATTGAAAAATAAAATCAATAAAAGCTTAGAGATTAAGAACTTAAATTGTAGGAT
TTACAAAACTAAAAGAAAGAATTTGATCTGAAATTAATGGAATAAGAAGAAAAGAATAAC
TAATATATCACAGAGTTGTAGAAAATCATAGAGTAATAATAGGAAGACTTAAATAAAATG
GAGCAATGCTTATACGAAAACAACGGATCTTAGGACGAAATAAATAATTTAAGATCTGAG
ATTGAGAAATAGTAAAATGAATTGGATGAAAAGAGCAATGAAATTAATTAAAAAGAAAAG
GAATTAGAAGATATGTTCCAACAAATGCAAGAGGTAGAGAGATAATACCAAGATAAACTC
AATGAAACAGAGTCTAAACTTAAGGAATTGCAAAACTAAAATAATGAGATAATAGGAAAA
TTTGAAGAGTCTGAATAAAAGAGCAATTTCCATATTTCTGAATTGTAGAAAATCATCGAT
TAGCAATAAGAAATGATTGGTAGAATGGATCAAGATTTGTTTGATACTTCAAGATAGCAA
GAAGAGAACAATAGTTTAAGAATGGAATTAGAGAGAAAAACTCTTCAGTTAGAACAAAGA
AATGCAGAAATATTATCTAAGAATAAAGAACTTGAAAGCAAATATGATTAGCTTGATAAA
ATTGAGAGATAATATTAACAAAAGCTAAGAGATTTTGAGCTTAAATAGCAAGATTTATAG
AATCAAAAGAAAGAACTTGAATTAAGACTCCTTGAATAAGAAGAAAATGGTGGCAGCTTA
GAAAAGTTACAAAGAGAATTTGAAATGCAAAAGAAAGAGTTAGAAAATATTCTAGATAAA
TAGCAAATAGAAATCGAAGAACTAAATGATAAGCTTATCAGATAGAGAGAAGACTACGAA
TACTAGCTCGCCCAAGCCAATAACAGAATCCAATCTATTGAGCTCGATCATAAAACTGAA
ATTAAAAAATTAATGAAATTGCAAGAAGAGCTCCGTCTTTAAAATAGAGATATGGAAAAT
AAATACGAGAGACTAAAAGAAGACCACAAGAATATCCAAAACAGTTCCTTTAACAATTCT
TTTGATGCAAATAACAAACTTGGAACTCCTAACAAGAGAGTCTCAGATTTACCACCTAGA
TAACTCTTGCCTAGTGGTACAATTACAGGTACTTCTTAATAATACGGAGTTAGATAATCA
AAAGATCTTACAGCTGCCCCAGGCTCGATTAGCGGAACAAATTAACAACCTGCTTACACA
TCTCCTGTTTCTATGAGATTAAACTCATAAGAAGACTAAAAGTCTAGATATAGCTAGAAT
TCTCCTCAATAGCCTCATCAAGCTGTTTCTAGTACAGCTTTTAACCATCATAGCAATGTT
ATTTTGGATCAAGCTTATATGAAGTGCATTGAACGTTCAAAGAATCTCCTTAGTAAGAAT
GAAACTATCTTAAATAACTTGAAAGCAACAAATTCCGTTGAAAGACCACTTAAATACTAA
TATTCTCCTTCTTAATAAATGAATAACAATAATAGTTTCACTAACTTGCACAACTCAAGC
AATTTAAATAATTTACCTTCAAATGGTATCCCTGCCAGCTAGGTTGGTAGCAACAACTAT
CCTCCTGCTCAGTAACAAAGAAACTCTTCCCTTGTAAATCAAAGTTCATCTCATTCAACC
CCTAAAGGACCTCAGTACATCAAAAAGCTTGATAACCGTCCACCATTCCTTTAACTTCCA
GCAGGGCAATAATAATTGCAGTAATAATAAATACAAGGATAATAATAATAATAATAGCCA
GTTCATTAATAATAATCCTCTGTATAAAACTTCTCTTAAATAAGAACGATTAGCAATTCA
ACAACCCAATAGCCTAAACGTCCTCCTATTATTGAACAATAGAGAAATAGAACCTCCTCA
ATCGATTAGAGTTAAAATAATTTATACTTATAATAGCAATAGTAAATGCAATCTATTTAA
TAATAACAACAACAATTGCAACAATAATAAGATCTCATCAACAACTAAAATCGCAGCAAG
TCTTCTAATTAAAATAATTATCCTTAATTATAATAGCAATAACAACAATAGTAACTTCTC
TAGCAATAGTAATAATAAAATTTAATCAAAAAGTAGAATACTTAACCTACTACTGGTAAT
ACAGTTTAAAGTTAAGTTATGCCTAAATATGAAGGTGAGCGTTTAGGAAATCTAAGACAC
GGAAGAGGAAGATGCTACTATCCTAACGGAGAACTCTATGAAGGAGAATGGAAGAGTGAC
AAGCGTCATGGATATGGCATATTGAGAGATTAAAATGGAGAAATTTATAATGGAGATTGG
GAATTCGATCTTTATCACGGATAAGGAAGACTAAGAAATAAATTCTGCGAGCCTTTAAAT
AAAGAATTTGATTTTAGAAACTTCGAAAACTTGAGGAACTATTGGAGCAGTTACTCAGGA
GAATTCAAAAATCATTCATTACATGGTTTGGGAACCCTCATCCTATCAAATGGTGAAAAA
TTCTTAGGATCTTTTGCTGGTGGTAAAGTTCATGGTGAAGGTACTTTCTATAGATCAAAT
GGAGAAATAGAAGTAGGTTTTTGGTAAAATAATAAATTCATTGGAAAGTTATGA


>TTHERM_00127110(protein)
MNDSDLYQDSSQEGSSRKEDQNHKNPLFDEIQADGDAADFDLDSHNESKSAQKNYDLEDS
PQGPTQEQISPNKDQYSDQQELDEVNQVQEKSVEKNDNFESSDFKKYLNNDENENYKYFE
EQQEEEEEERQNESSQGEQVREEALQYQQKNSLFDDLQGEADFDINQSSSRKDTQNSERL
YSQGDEDFVQQNTQKHQQENESIFYKQRNQPDDQQSQEQEQKQQDEIIAFNQEENVDNQN
KEQDADNEKVKESEEGDSLSNNNEKTNFEAQIQQQVDQGDDQHLIKLLNPSEEVEASIKN
NSNLHEENLQQSDQKDQQVKGEDIYQGNEEEMSNQDQNQEEANDQLENDSNIQENKSIKQ
DQEEIKTPIKQQEEESQQDIQTEIQVEQENHMEKQGQQQVEVDNKNENSNLEEVSNQEEQ
SLREQQINDEINQLEDDKHSEQKQFDQDQQSREENIQSEVFKQDRDNHQQNEAQQYQQEE
EEEQESLKQEEYPSELKQSMNDSELYRNSSFENSQFNQYQKDNLHNQEEEQQSPKIGSSS
VLNNYKLEDSPSRPAAAGDSRKQSDNYEQDLYYKDHIQELHNQQEYKSEYQPSPQKEDYD
DLESDGFDTLKMNANDQNDQSSHKYGIQVHIEKSLAPEQAVDENNLENNLLNPIEKKQQI
MSLGDSALKDILNEIKTFKQEKQQKDPEEIVMRLSTLLQELEVQNLNNSLKLSQNQIPND
SQIEKDFEQKIQASLQKESLKKEEKQNSEAQKDEVTEFNQEDKIDKEEFQKEKEIITKEK
EELIQLKEDLRKQKEDFNKQKQEVEKQKSELELKAENLNLISMQFEEREKELEEVQNTLQ
QQQEELSQKRKQYEQIQDKLELLEQKEQHVKEREETLAQQIEFLKEKDIYVNDREQELLD
KERELESLFEEQKEKEKYLENLINEQNQKLKLLEQQSINQQSEDLKLLEQQFINEQNEKL
KLLEQQLINEQNEKLKNLEEKLVNEQNEKLKLLEQQLDEHQAKEKALEQLLKENDGKQKE
LDLLISQQAEKEQVLQQLMEQQKQREYEFEQIVNEQKQKEQELEQLFSEQSKIKHQLEQQ
LAQQIEKEQELDQLINEAQSRNQATFTEEQEIVLTTPKKEERQERTVQEGRNEDFTEGND
ENEEELELRLKKEVEDLQQQLQISAQKNQESAKKIIDLEKAVQNYQMIERDEKNFEEIFR
QNKKLEDKIKSYEMEYSARKNQLEHQEQTIAKLHSQLVQADADLQKYIEDKRLLNDKIEA
LKYEKEEEIKRLKQENDIEKMSRSQSKLMESESIAFESIVGDYKDTINMLSNKCEDYETQ
IQNLTKQNNVLVNSFKEIKSNLTSYQEELDNKEEFIQKQSQDMFELQKSVNQYKQMAKKL
EDQLKDLSNKSQEESSTLQYELEKNNILLEQKNKDVQAKNQEIQSLYEKISLIEKSNLQK
LEDLNLVIQEEQNQRKEIQTELEQLVDKYNQDVQELQKVMDQQQEEFTQIQQQLQESSQN
QQKENLNLKEQMEHLKQQLDQKNAEIVSKQEELLNLEDMLQKIENDLKQQKHEFDLQIQK
QEDSNNQHVDQLQKIIDEKQEEISLLQQNQQDSSLRSQEDLKILKIKLDNLVSELNNANE
QLNEMDKELQFKDEQLKLTEKEYQMNINQLQVKQNDLQDQKKQLEEMLQEQEERYSQEIT
QLQNIIDQQQEDLQGLQQNLLGSSKIQEDKNKALTNELQQAKQEIEKMNHQLQAQHKDLE
KAYQQFDDSEKQNQQKLKSAEVKLQDLEAKYKDLQESIQIEQEKYSKDIEELQNIIETQQ
QEINLMEQNMTKLKNDLDRKVKDLDVKNIEIQAKDSDLESAYAQIDKIDIQYQHKLNEYE
SKQQELANNNNHLEGKLIELEDKYNKDVSELQKVIEQQQQDLNNLEQELYNQGSQNEETS
NLRVELEKVSIQLDERNSEILIKNKELDSMYEQIDKIERQYQQKLREQEIKIQDLQKLKK
EYDQQLLELDNKNSQDIADLKNIIEQQQEDLNNMQKDLFENTKHQEENNNLRFELERKNI
QLNSDLIQKNKELDQLHEQINKIEKQNQQKLRDQELKLQDLQNQKKEFDLKLMEQEEKNN
QYITELQKIIEQQQEDLNKMEQCLYENNGSQDEINNLRSEIEKQQNELDEKSNEINQKEK
ELEDMFQQMQEVERQYQDKLNETESKLKELQNQNNEIIGKFEESEQKSNFHISELQKIID
QQQEMIGRMDQDLFDTSRQQEENNSLRMELERKTLQLEQRNAEILSKNKELESKYDQLDK
IERQYQQKLRDFELKQQDLQNQKKELELRLLEQEENGGSLEKLQREFEMQKKELENILDK
QQIEIEELNDKLIRQREDYEYQLAQANNRIQSIELDHKTEIKKLMKLQEELRLQNRDMEN
KYERLKEDHKNIQNSSFNNSFDANNKLGTPNKRVSDLPPRQLLPSGTITGTSQQYGVRQS
KDLTAAPGSISGTNQQPAYTSPVSMRLNSQEDQKSRYSQNSPQQPHQAVSSTAFNHHSNV
ILDQAYMKCIERSKNLLSKNETILNNLKATNSVERPLKYQYSPSQQMNNNNSFTNLHNSS
NLNNLPSNGIPASQVGSNNYPPAQQQRNSSLVNQSSSHSTPKGPQYIKKLDNRPPFLQLP
AGQQQLQQQQIQGQQQQQQPVHQQQSSVQNFSQIRTISNSTTQQPKRPPIIEQQRNRTSS
IDQSQNNLYLQQQQQMQSIQQQQQQLQQQQDLINNQNRSKSSNQNNYPQLQQQQQQQQLL
QQQQQQNLIKKQNTQPTTGNTVQSQVMPKYEGERLGNLRHGRGRCYYPNGELYEGEWKSD
KRHGYGILRDQNGEIYNGDWEFDLYHGQGRLRNKFCEPLNKEFDFRNFENLRNYWSSYSG
EFKNHSLHGLGTLILSNGEKFLGSFAGGKVHGEGTFYRSNGEIEVGFWQNNKFIGKL


>TTHERM_00127110(gene)
ATGAACGATAGCGACCTATACTAAGATAGCAGCTAAGAAGGTTCATCAAGAAAGGAAGAT
CAAAATCATAAAAATCCACTTTTTGATGAAATCTAAGCAGATGGCGATGCTGCAGATTTT
GATTTAGACTCTCACAATGAATCTAAAAGCGCATAGAAAAACTACGACTTAGAAGACTCA
CCCTAAGGACCTACTCAAGAGCAAATAAGTCCTAACAAGGATCAATATAGTGACCAATAA
GAATTAGATGAAGTTAATCAAGTCCAAGAAAAGTCTGTAGAAAAAAATGATAACTTCGAA
AGCAGTGATTTCAAAAAGTATCTCAATAACGATGAAAATGAAAATTATAAATATTTTGAA
GAGTAGCAAGAAGAAGAGGAAGAAGAAAGATAGAATGAAAGTTCATAAGGAGAACAAGTA
AGAGAAGAAGCTTTACAATACTAGCAAAAGAATAGTCTTTTTGATGATTTGCAAGGAGAA
GCAGACTTTGATATCAATTAAAGTTCATCAAGAAAAGATACTTAAAATAGCGAGAGACTT
TATTCTTAAGGAGACGAAGATTTTGTTTAACAAAATACTTAAAAGCATCAATAAGAGAAT
GAAAGTATATTTTATAAGTAAAGAAATCAACCAGATGATTAGTAGAGTTAGGAGCAAGAA
TAAAAGCAATAAGATGAAATTATTGCTTTTAACTAAGAAGAAAATGTAGATAATCAAAAC
AAAGAATAAGATGCTGATAATGAAAAAGTAAAAGAGAGTGAAGAAGGAGACAGTCTTTCA
AATAACAATGAAAAAACAAATTTTGAAGCATAAATATAATAATAAGTTGATCAAGGAGAT
GATTAGCATTTGATTAAGCTGCTCAATCCTTCTGAAGAAGTAGAAGCCTCAATCAAAAAC
AACTCAAACTTGCATGAAGAAAATTTATAGTAAAGTGATTAAAAAGATTAGTAGGTTAAG
GGAGAAGATATCTATCAAGGAAATGAAGAAGAAATGAGTAACCAAGATTAAAATTAGGAA
GAAGCAAATGATTAATTAGAAAATGATTCAAATATTTAAGAAAATAAAAGTATAAAGCAA
GACTAAGAAGAAATTAAAACTCCAATCAAATAATAAGAAGAAGAAAGTTAGCAAGATATT
TAAACAGAAATTTAAGTTGAATAAGAAAATCACATGGAAAAACAAGGACAATAACAAGTA
GAAGTTGATAATAAGAATGAAAATTCAAATTTAGAAGAAGTTTCTAATTAAGAAGAGTAA
AGTTTAAGAGAGTAGCAAATAAATGATGAGATAAATTAGCTAGAAGATGATAAGCACAGT
GAATAAAAGTAATTTGATTAAGATTAATAAAGCAGAGAAGAAAATATCTAATCAGAGGTA
TTCAAGTAAGATAGAGATAATCATTAATAAAATGAAGCTTAGCAATATTAATAAGAAGAA
GAAGAAGAATAAGAAAGTTTGAAGCAGGAAGAATATCCTAGCGAATTAAAATAATCTATG
AATGATAGCGAATTATATAGAAATAGCAGCTTTGAAAACTCTTAATTTAACTAGTATCAA
AAAGATAATTTACATAATTAAGAGGAAGAGCAGCAATCTCCTAAGATAGGATCATCAAGT
GTTTTGAATAATTATAAACTTGAAGACTCTCCTTCAAGACCTGCTGCAGCTGGGGATTCT
AGGAAATAATCTGATAACTATGAATAAGACTTGTATTACAAGGATCATATTTAAGAATTA
CATAATTAGTAAGAATATAAAAGTGAGTATTAGCCTTCTCCTCAAAAAGAAGACTATGAC
GATCTTGAATCAGATGGATTCGATACTCTTAAAATGAATGCTAATGATTAAAATGATCAA
TCTTCTCATAAATATGGAATTCAAGTCCACATTGAAGTAAAATAATAAAATTCACTTTGA
GTTATTTTTTATATTTAAAATATTTTTATATTAGAAATCATTAGCACCTGAATAGGCAGT
TGACGAAAATAATCTTGAAAACAATTTGTTAAATCCTATTGAGAAAAAATAATAAATTAT
GAGTTTGGGAGATAGCGCATTAAAGGATATTTTAAATGAAATAAAAACATTCAAACAAGA
GAAGTAACAAAAAGACCCTGAGGAAATAGTAATGAGACTTAGCACTTTATTGTAAGAATT
AGAGGTCTAAAACTTAAATAATTCTTTAAAGCTTTCTTAAAACTAAATTCCTAACGATTC
TTAAATAGAAAAAGATTTTGAGTAAAAGATTTAAGCCAGTCTTTAAAAAGAGAGCCTTAA
GAAAGAAGAAAAGTAGAATTCTGAAGCTTAAAAGGATGAGGTCACTGAGTTCAATCAAGA
AGATAAAATTGATAAGGAAGAATTTCAAAAAGAAAAAGAAATTATCACAAAAGAAAAGGA
AGAATTAATTCAGTTAAAAGAAGATCTCAGAAAGTAGAAAGAAGATTTCAACAAATAAAA
ATAAGAGGTTGAAAAATAAAAGAGTGAATTAGAATTGAAGGCAGAAAATTTAAATTTAAT
TTCAATGTAATTTGAAGAAAGAGAAAAGGAGCTCGAAGAAGTATAAAACACGTTATAATA
GTAATAAGAAGAGTTAAGCTAAAAGCGCAAATAATACGAACAAATTTAAGATAAATTAGA
GTTGTTAGAGTAAAAAGAGCAGCATGTTAAAGAAAGAGAAGAAACTTTAGCTTAATAAAT
TGAATTCCTTAAAGAAAAAGACATTTATGTAAATGACAGAGAATAAGAATTATTAGTAAA
TACTTTTTTTTGTTTGAATTTACTTATTAGATTTAAATATATTTTGTAAAAATTTGATGA
AACTTAAATATTTATTTTATATTAGGATAAAGAAAGGGAATTAGAGTCATTGTTTGAAGA
ATAAAAAGAGAAGGAGAAATATTTAGAGAATTTAATTAATGAATAAAATCAAAAATTAAA
ACTTTTAGAGCAACAATCAATTAATCAATAAAGCGAAGATTTGAAACTTTTAGAGCAACA
ATTTATTAATGAATAAAATGAAAAATTGAAACTTTTAGAGCAACAATTAATTAATGAATA
AAATGAAAAATTGAAAAATTTAGAAGAAAAATTAGTTAATGAATAAAATGAAAAGTTGAA
ACTTTTAGAGCAACAATTAGATGAACATTAAGCAAAAGAAAAGGCTTTGGAGTAATTGCT
AAAAGAAAATGATGGTAAATAAAAGGAGCTAGATTTGCTTATAAGTTAGTAAGCAGAGAA
AGAGTAGGTCTTATAATAATTGATGGAGTAATAGAAGTAGAGAGAATATGAATTCGAGCA
AATTGTTAATGAATAAAAATAAAAAGAATAGGAGCTTGAATAACTATTCAGTGAATAATC
TAAGATCAAGCATCAACTTGAGTAATAATTAGCTTAATAAATAGAAAAAGAATAAGAACT
TGATTAGTTAATTAATGAAGCTTAGTCTAGAAACCAAGCAACTTTTACAGAAGAATAAGA
AATCGTATTAACCACACCAAAGAAAGAAGAAAGACAAGAAAGAACTGTTTAAGAAGGTAG
AAATGAAGACTTTACTGAAGGAAATGATGAAAATGAAGAGGAATTAGAATTACGTTTAAA
AAAAGAGGTTGAGGATCTTTAACAATAACTTTAGATAAGTGCTTAGAAAAACCAAGAATC
TGCTAAGAAAATCATAGACCTTGAAAAGGCTGTATAAAATTACTAAATGATTGAAAGAGA
TGAAAAAAATTTTGAAGAAATCTTTAGGTAAAACAAAAAACTTGAAGATAAAATTAAATC
ATATGAAATGGAATATTCAGCTAGAAAGAATTAGCTAGAGCATTAGGAATAAACTATTGC
TAAATTGCATTCCTAGCTTGTTTAGGCTGATGCAGATCTATAAAAATATATAGAAGATAA
ACGATTACTTAATGACAAAATCGAAGCTTTAAAATATGAAAAGGAAGAAGAAATAAAAAG
ACTAAAGTAAGAAAATGATATTGAAAAAATGAGCAGAAGTCAAAGTAAATTAATGGAAAG
TGAAAGTATTGCTTTTGAATCAATTGTTGGTGATTATAAGGATACTATCAACATGCTCAG
CAATAAGTGTGAGGATTACGAAACTCAAGTAAACTTTAATTTTACTAAATTTATTTAATA
CTAATATAAATTTACTTATTGAATATATTCAAAATTAAAATATTATTATTTAATAGATAC
AAAATTTAACAAAGCAAAACAATGTTCTTGTTAATTCGTTTAAAGAAATCAAGTCAAACT
TAACCTCTTACGTAATTAATTTTAACTTAGAATTAAATATTCATTTATATTTTTAAAGAT
ATTTCAAATGATAATTTAACTTAATAAGAATAATGAATTAAATATTTATTTATTTACTTA
AATAATTTAATAATAATTAGTAAGAAGAGCTAGATAACAAAGAGGAATTTATCTAAAAGT
AATCTTAAGATATGTTTGAATTATAAAAGAGTGTTAATCAATATAAGCAAATGGCAAAGA
AGTTAGAGGATTAGTTGAAAGATTTGTCTAACAAATCTTAAGAAGAATCTAGCACTCTTT
AATATGAATTAGAAAAAAACAACATATTGCTAGAATAAAAAAATAAAGATGTGCAAGCTA
AAAATTAAGAAATTTAAAGTTTGTATGAAAAAATCTCATTGATTGAAAAATCAAATTTAT
AGAAATTAGAGGATCTCAATCTTGTCATTCAAGAAGAGCAAAATTAGAGAAAAGAAATAT
AAACAGAACTTGAATAGTTGGTTGATAAATATAATTAAGATGTTTAGGAATTACAAAAGG
TAATGGATTAATAATAGGAAGAATTTACTCAAATTTAATAACAATTGTAAGAATCAAGTT
AGAATTAATAGAAAGAAAACTTAAACTTAAAAGAATAAATGGAACATCTCAAATAATAAT
TAGATTAAAAAAATGCAGAAATTGTTTCTAAACAAGAAGAGTTGTTGAATCTTGAAGATA
TGTTACAAAAAATTGAAAATGATTTAAAATAACAAAAGCATGAATTTGATTTGTAAATTT
AAAAATAAGAAGATAGCAATAACTAACATGTTGACTAATTGTAAAAGATAATTGATGAAA
AACAAGAAGAAATTAGTTTATTATAATAAAATTAATAAGATAGCAGTTTGAGATCTTAAG
AAGACTTAAAGATTTTAAAGATCAAATTAGACAATTTAGTTTCTGAATTGAATAATGCAA
ATGAATAACTGAATGAAATGGATAAAGAATTACAGTTTAAAGATGAATAACTTAAATTAA
CTGAGAAAGAATATTAAATGAATATTAATTAATTACAAGTTAAGCAAAATGACTTACAAG
ATCAAAAAAAATAATTAGAAGAAATGCTATAGGAATAAGAGGAAAGATATAGCCAAGAAA
TAACTTAATTGTAAAACATAATTGATTAATAATAAGAAGATCTTTAAGGCTTGTAATAGA
ATTTGTTAGGAAGCTCAAAAATCTAAGAAGATAAAAACAAAGCTTTAACTAATGAATTAT
AATAGGCTAAGCAAGAGATTGAAAAAATGAATCATTAATTATAGGCTTAACACAAAGATT
TAGAAAAGGCTTACTAGTAATTTGATGATAGCGAAAAGCAAAATTAACAAAAATTAAAGT
CCGCAGAAGTTAAATTGCAGGATTTAGAGGCTAAATACAAAGATTTATAAGAATCTATAT
AAATTGAGTAAGAAAAATATAGTAAAGATATTGAAGAGCTTCAGAATATTATTGAGACTT
AATAGCAAGAGATTAACTTAATGGAGTAAAATATGACAAAGCTGAAAAATGATTTAGACA
GAAAGGTCAAAGATTTAGATGTTAAAAATATTGAAATTCAAGCAAAAGATAGTGATTTGG
AAAGTGCTTATGCTTAAATTGATAAAATTGATATATAGTATCAACATAAGCTTAATGAAT
ATGAATCTAAATAGTAAGAACTTGCAAATAATAACAATCATTTAGAAGGAAAGTTAATTG
AGCTAGAAGATAAATATAATAAAGATGTTTCAGAACTTTAAAAAGTTATTGAATAATAAT
AATAAGACTTGAATAATTTGGAATAAGAATTATACAATCAAGGTAGTCAAAACGAAGAGA
CTAGTAATCTTAGAGTTGAGTTAGAAAAGGTTTCTATTTAATTAGATGAAAGGAACAGTG
AAATATTAATAAAGAACAAAGAGCTAGATAGCATGTATGAATAAATTGATAAAATCGAGA
GATAGTATCAACAAAAGCTTAGAGAGCAAGAAATCAAAATACAAGATCTCTAAAAACTAA
AAAAAGAGTATGATTAGTAATTGTTAGAGTTAGATAATAAAAATAGCTAAGACATTGCCG
ATTTAAAGAATATTATTGAGTAGTAATAAGAGGATTTGAATAATATGCAAAAAGATTTAT
TTGAGAACACTAAACATTAAGAAGAGAACAATAACTTAAGATTTGAATTGGAAAGAAAGA
ATATTCAACTTAACAGTGACCTCATTTAAAAAAATAAAGAGTTGGATTAATTGCATGAGT
AGATAAATAAGATTGAAAAATAAAATCAATAAAAGCTTAGAGATTAAGAACTTAAATTGT
AGGATTTACAAAACTAAAAGAAAGAATTTGATCTGAAATTAATGGAATAAGAAGAAAAGA
ATAACTAATATATCACAGAGTTGTAGAAAATCATAGAGTAATAATAGGAAGACTTAAATA
AAATGGAGCAATGCTTATACGAAAACAACGGATCTTAGGACGAAATAAATAATTTAAGAT
CTGAGATTGAGAAATAGTAAAATGAATTGGATGAAAAGAGCAATGAAATTAATTAAAAAG
AAAAGGAATTAGAAGATATGTTCCAACAAATGCAAGAGGTAGAGAGATAATACCAAGATA
AACTCAATGAAACAGAGTCTAAACTTAAGGAATTGCAAAACTAAAATAATGAGATAATAG
GAAAATTTGAAGAGTCTGAATAAAAGAGCAATTTCCATATTTCTGAATTGTAGAAAATCA
TCGATTAGCAATAAGAAATGATTGGTAGAATGGATCAAGATTTGTTTGATACTTCAAGAT
AGCAAGAAGAGAACAATAGTTTAAGAATGGAATTAGAGAGAAAAACTCTTCAGTTAGAAC
AAAGAAATGCAGAAATATTATCTAAGAATAAAGAACTTGAAAGCAAATATGATTAGCTTG
ATAAAATTGAGAGATAATATTAACAAAAGCTAAGAGATTTTGAGCTTAAATAGCAAGATT
TATAGAATCAAAAGAAAGAACTTGAATTAAGACTCCTTGAATAAGAAGAAAATGGTGGCA
GCTTAGAAAAGTTACAAAGAGAATTTGAAATGCAAAAGAAAGAGTTAGAAAATATTCTAG
ATAAATAGCAAATAGAAATCGAAGAACTAAATGATAAGCTTATCAGATAGAGAGAAGACT
ACGAATACTAGCTCGCCCAAGCCAATAACAGAATCCAATCTATTGAGCTCGATCATAAAA
CTGAAATTAAAAAATTAATGAAATTGCAAGAAGAGCTCCGTCTTTAAAATAGAGATATGG
AAAATAAATACGAGAGACTAAAAGAAGACCACAAGAATATCCAAAACAGTTCCTTTAACA
ATTCTTTTGATGCAAATAACAAAGTAATAAATTCAATATCAATTTTCAATTTAACATAAT
TAAAAATTTATAATTAATTTAAATTTTAAACAGCTTGGAACTCCTAACAAGAGAGTCTCA
GATTTACCACCTAGATAACTCTTGCCTAGTGGTACAATTACAGGTACTTCTTAATAATAC
GGAGTTAGATAATCAAAAGATCTTACAGCTGCCCCAGGCTCGATTAGCGGAACAAATTAA
CAACCTGCTTACACATCTCCTGTTTCTATGAGATTAAACTCATAAGAAGACTAAAAGTCT
AGGTATATTAAAATTATGTTTAAAAATAGCTTATAATAAATATTTTTAATGAATAGATAT
AGCTAGAATTCTCCTCAATAGCCTCATCAAGCTGTTTCTAGTACAGCTTTTAACCATCAT
AGCAATGTTATTTTGGATCAAGCTTATATGAAGTGCATTGAACGTTCAAAGAATCTCCTT
AGTAAGAATGAAACTATCTTAAATAACTTGAAAGCAACAAATTCCGTTGAAAGACCACTT
AAATACTAATATTCTCCTTCTTAATAAATGAATAACAATAATAGTTTCACTAACTTGCAC
AACTCAAGCAATTTAAATAATTTACCTTCAAATGGTATCCCTGCCAGCTAGGTTGGTAGC
AACAACTATCCTCCTGCTCAGTAACAAAGAAACTCTTCCCTTGTAAATCAAAGTTCATCT
CATTCAACCCCTAAAGGACCTCAGTACATCAAAAAGCTTGATAACCGTCCACCATTCCTT
TAACTTCCAGCAGGGCAATAATAATTGCAGTAATAATAAATACAAGGATAATAATAATAA
TAATAGCCAGTTCATTAATAATAATCCTCTGTATAAAACTTCTCTTAAATAAGAACGATT
AGCAATTCAACAACCCAATAGCCTAAACGTCCTCCTATTATTGAAGTATTATTTTTTTAT
ATAATTTGAAACTAAAATTTATAATATTATCTTTATAAAAAAGCAATAGAGAAATAGAAC
CTCCTCAATCGATTAGAGTTAAAATAATTTATACTTATAATAGCAATAGTAAATGCAATC
TATTTAATAATAACAACAACAATTGCAACAATAATAAGATCTCATCAACAACTAAAATCG
CAGCAAGTCTTCTAATTAAAATAATTATCCTTAATTATAATAGCAATAACAACAATAGTA
ACTTCTCTAGCAATAGTAATAATAAAATTTAATCAAAAAGTAGAATACTTAACCTACTAC
TGGTAATACAGTTTAAAGTTAAGTTATGCCTAAATATGAAGGTGAGCGTTTAGGAAATCT
AAGACACGGAAGAGGAAGATGCTACTATCCTAACGGAGAACTCTATGAAGGAGAATGGAA
GAGTGACAAGGTAATTTAATTTAATAATAAAAATTTTTTTAATTCATTTTAAATTCACAG
GATAAAATTTAGTTTCTCTTTAAAAAAAGAATTTTATTTATTTTAATTTTTGAAAGTTTT
ATTTAAGATAAAATAAATTATTTTATTATTTTAAAAAAGCGTCATGGATATGGCATATTG
AGAGATTAAAATGGAGAAATTTATAATGGAGATTGGGAATTCGATCTTTATCACGGATAA
GGAAGACTAAGAAATAAATTCTGCGAGCCTTTAAATAAAGAATTTGATTTTAGAAACTTC
GAAAACTTGAGGAACTATTGGAGCAGTTACTCAGGAGAATTCAAAAATCATTCATTACAT
GGTTTGGGAACCCTCATCCTATCAAATGGTGAAAAATTCTTAGGATCTTTTGCTGGTGGT
AAAGTTCATGGTGAAGGTACTTTCTATAGATCAAATGGAGAAATAGAAGTAGGTTTTTGG
TAAAATAATAAATTCATTGGAAAGTTATGA