Identifiers and Description

Gene Model Identifier

TTHERM_00373800

Standard Name

MRNC27 (Membrane Occupation and Recognition Nexus protein C-terminal)

Aliases

PreTt28694 | 39.m00267 | 3693.m00110

Description

protein with predicted MORN domains localized at the C-terminus of the protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF02493 ) MORN repeat
  • ( PF08243 ) SPT2 chromatin protein
  • ( PF06320 ) GCN5-like protein 1 (GCN5L1)
  • ( PF08616 ) Spindle pole body interacting protein
  • ( TIGR00290 ) MJ0570-related uncharacterized domain

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00373800

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_12318.19.997093137033517e-262hypothetical protein (1001 aa)
OxytrichaContig22456.0.g762.9991172563576427e-86Transport protein Avl9
SGDYLR114C8.003782782428492e-46AVL9 Conserved protein involve
d in exocytic transport from t
he Golgi; mutation is syntheti
cally lethal with apl2 vps1 do
uble mutation; member of a pro
tein superfamily with ortholog
s in diverse organisms
WormBaseWBGene000208228.996157222146379e-27status:Confirmed UniProt:Q22
794 protein_id:CCD63212.1
DictyBaseDDB_G02852011.0002124404074584e-26DDB_G0285201 on chromosome: 4
position 2968644 to 2971150
Stentor CoeruleusSteCoe_291132.1151310375910805e-19

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00373800(coding)
ATGAAAAAATGGATAGAAAAAGGAAAGTAATTCCTAAAAAAGCTTGAAGAAGATCATGAT
AAAAAGAAAAAAGAGGCAAAATAGAATTAGGATAAGTAACAAAGCGAAGAAGAAAAGAAA
GAGTCCATGATGTCAAAATCATTAGATGACGATAAGATGTATAAATTAGGGTAGTTATTG
CTAAATCCAACTCCTTTAGAAGATAATAACAAATTTAAATTGCAGAATTCAGCATTTTTT
AGACAGCAAATTAACTATATTTCTCTTTGCGAGTAGCTAAGAAAAAATAATCACGAGATC
GATTTCTAATCATAAGGATTTTAGTAGCTGCTGAAATAAATTTACAATCAAGATCAAGAG
TATTAGGCACCAATAATTGAGCAAAATCCACTTTTTTTGATAGGAGTAGTTGGTTTTCAT
CACAAAAAAGGTTCAGTAGTAGAGTTTTTCCATCCTTCAAATATGAATGATTTAAATTAA
GAATAGCAATAGTATATTTTGGATTCTTTACCAAACTATTGTATGCCAGATGCTATTCAC
AATAAAAATGAAGATTACGTTTACTTCACTCTTACAATAAAGCTAAATAGCAATGAATAC
ACTCTAAATAATTAAAATGAGCAAAGTTAAAATTTAGTTTAAACTACAAAGTAAGTTACA
CTGTTTGGTGTTTCATATTTTAAATAAATAAAGGTTAATGAAAAGATGAGATAAATGGAT
AAAGAATTAACAAGAAGTCATTTGCAAAAATCTTTATTTGTATTGAGCACTGTACCTTTA
CAAGGCTATATTATGGGTAGACTTGAGCCTACCACTAAGGCCTACTTTGATTAAGAAAAT
ATAACAGACTATGAAATACTCAAATGTGCTTATGATAATATGAATTTAACTCTTAAAAAT
AATTAAAATATTTAAGAAAGTGAGATATATATTGGCACCTCATTAAAGACTATGATTCAC
TTCTTTAAAGAAAAGACTTTAGTTATTTTAAAAGCTTTATTACTTTAAAAAAAAATTTTG
GTTTACTCACTGCACAGCTGCTCTACCAGTAATTTTGTAATGAGTTTGATTAGCTTAATA
CCCGGTCTTTCATTTTTCAAGTTCAAAAGTAAATATATAGATATAATATAAAGTGCTCTT
GGTGAGTATGGATTACCTTTAAGAGTTTTTAATGAGCAAGACTGTCCTTTGGAATTATAC
TTTACGATCTAATAATTAGATAATATGGATAAATATAAAGGTTACCTTATAGGTACTACA
AACTAGTTAATAAGGTCTCATAAAAAAACTGGAGCTGATTTAATAGTTGATTTGGATACA
AACTAACTCATCATCTAAAATGAAGCTATAAAGACATCTCTTTAACTAAATTCTGAAGAA
AAAAAATTTATGGAAGGTATCACTAAAACAGTCAATAAAGTAGTTAGTGAAAGTGATAAA
AACTGGAAAAATATGGAATACAGTTAAAACGATAGCTCATTTATTGGTAGTAATGATTGG
ATTAGATAACAGTTCACTAAATACATCATAGATTTGCTTTGTGAGATAGAACTTGTAAAA
AAAAGGTATAGAGATTTCTAAGATGAAATATCAAATAGACTAAAAAGAAAATCAAGCTTA
GGAAAAAAAGATGATGCAAGAATTAACCAAAAGTTAGATAAATTAGAGAATAACTTAAGT
CACAGAAAAGAAAAAGATGAATTTTAAATAGAATCAGGTAATCAAGATCATTAAATTCAA
TAATCTTAGTCAACTACTGCTTCAACTATTTCAGATTTAGATAGTAAATAAGAAATTACT
TAAAAAAGGAAAGTCAGTAATCTCTCAGAAAAAAGCTAAAACAGCAATGATGAAGAAATA
ATAAATGAGTTATTTGATGATTTTTTAAATTTTGACTCTGATGAAGAAGAATAGTAAGCA
AGTTACGGTCAGCAATCAAATAAATATGCTAAATTTAATTAGCTTGATGGAGACACTCTA
TTAGCTTTTAACATAGATTCAGAAGTATCCAAAACAGAAAAAATTTTTAAGCAAAAGAAA
AAACAGTTGAAAATTAGTTATGCAACTTTAAAGAAATACAATTTTAAATTTTTGAAAGAA
TTCTTTCTAACTGAAAATTATAAGTACTGGTTACTTCATCACGATGATTAAATATATTTA
CGTAGTATCAATTGTTCAGAGTTGACTTAAAGGTCTTGCATTACTCTTGAAAGTGGCTAA
ATATTCTTTGGTTCAATGTAAAATGGGGAAAGAAACGGAAAAGGTACAACATTTGATTAG
ATTTAAGGAAAGATTGAGCAATGTGAAAATTATGAAAATGATATGAAAAATGGAAAAACT
ACAATTGTAACCTTAAAAAACGACTATTACTTTGAAGGAGATTTTATTGATGATTAGAAG
CAAGGTTTTGGAAACTTAGTCACAGATAAATTGAAATATTGTGGTTCTTTTAATTTAGAC
AAGTTTAATGGTTAAGGAACTTTAGTAGATAAAGATTAAAGCTTATATGAAGGAGAGTTC
TAAAATAACATGAAAAATGGAATGGGCAAATATAGAAGTGGAGATAGCTCTATCAATTAC
GTTGGTTAATTTATTGACGATCTTTTTTCTGATAAAGGTTAGCTTGTGAAATCTAATGGT
GATGTTTACTGTGGAGATTTTAAAAAAGGGTAAATGCATGGTCAAGGTGAATATTAAAGT
GAAGGTTATTCATATACTGGAGAATTCTTGCATAACAAATTTAATGGCTAAGGATTTTAT
AAAGACCTAAAAACAAATAACATTTATTAAGGAGAGTTTGTTGAAAATCAGCTTGATCCT
GAACAATAACATATCATTAAATATCATAATGGAGATGTCTACAGTGGATTTATTAAAGAT
TGGTAACCTAATGGAGAAGGACTTATTTGTTACAAAGATGGAAAAATAGTAAAAGGAATT
TTCGAAAGTGGAATAATAAAATAATAATTTGAGTGA


>TTHERM_00373800(protein)
MKKWIEKGKQFLKKLEEDHDKKKKEAKQNQDKQQSEEEKKESMMSKSLDDDKMYKLGQLL
LNPTPLEDNNKFKLQNSAFFRQQINYISLCEQLRKNNHEIDFQSQGFQQLLKQIYNQDQE
YQAPIIEQNPLFLIGVVGFHHKKGSVVEFFHPSNMNDLNQEQQQYILDSLPNYCMPDAIH
NKNEDYVYFTLTIKLNSNEYTLNNQNEQSQNLVQTTKQVTLFGVSYFKQIKVNEKMRQMD
KELTRSHLQKSLFVLSTVPLQGYIMGRLEPTTKAYFDQENITDYEILKCAYDNMNLTLKN
NQNIQESEIYIGTSLKTMIHFFKEKTLVILKALLLQKKILVYSLHSCSTSNFVMSLISLI
PGLSFFKFKSKYIDIIQSALGEYGLPLRVFNEQDCPLELYFTIQQLDNMDKYKGYLIGTT
NQLIRSHKKTGADLIVDLDTNQLIIQNEAIKTSLQLNSEEKKFMEGITKTVNKVVSESDK
NWKNMEYSQNDSSFIGSNDWIRQQFTKYIIDLLCEIELVKKRYRDFQDEISNRLKRKSSL
GKKDDARINQKLDKLENNLSHRKEKDEFQIESGNQDHQIQQSQSTTASTISDLDSKQEIT
QKRKVSNLSEKSQNSNDEEIINELFDDFLNFDSDEEEQQASYGQQSNKYAKFNQLDGDTL
LAFNIDSEVSKTEKIFKQKKKQLKISYATLKKYNFKFLKEFFLTENYKYWLLHHDDQIYL
RSINCSELTQRSCITLESGQIFFGSMQNGERNGKGTTFDQIQGKIEQCENYENDMKNGKT
TIVTLKNDYYFEGDFIDDQKQGFGNLVTDKLKYCGSFNLDKFNGQGTLVDKDQSLYEGEF
QNNMKNGMGKYRSGDSSINYVGQFIDDLFSDKGQLVKSNGDVYCGDFKKGQMHGQGEYQS
EGYSYTGEFLHNKFNGQGFYKDLKTNNIYQGEFVENQLDPEQQHIIKYHNGDVYSGFIKD
WQPNGEGLICYKDGKIVKGIFESGIIKQQFE


>TTHERM_00373800(gene)
ATGAAAAAATGGATAGAAAAAGGAAAGTAATTCCTAAAAAAGCTTGAAGAAGATCATGAT
AAAAAGAAAAAAGAGGCAAAATAGAATTAGGATAAGTAACAAAGCGAAGAAGAAAAGAAA
GAGTCCATGATGTCAAAATCATTAGATGACGATAAGATGTATAAATTAGGGTAGTTATTG
CTAAATCCAACTCCTTTAGAAGATAATAACAAATTTAAATTGCAGAATTCAGCATTTTTT
AGACAGCAAATTAACTATATTTCTCTTTGCGAGTAGCTAAGAAAAAATAATCACGAGATC
GATTTCTAATCATAAGGATTTTAGTAGCTGCTGAAATAAATTTACAATCAAGATCAAGAG
TATTAGGCACCAATAATTGAGCAAAATCCACTTTTTTTGATAGGAGTAGTTGGTTTTCAT
CACAAAAAAGGTTCAGTAGTAGAGTTTTTCCATCCTTCAAATATGAATGATTTAAATTAA
GAATAGCAATAGTATATTTTGGATTCTTTACCAAACTATTGTATGCCAGATGCTATTCAC
AATAAAAATGAAGATTACGTTTACTTCACTCTTACAATAAAGCTAAATAGCAATGAATAC
ACTCTAAATAATTAAAATGAGCAAAGTTAAAATTTAGTTTAAACTACAAAGTAAGTTACA
CTGTTTGGTGTTTCATATTTTAAATAAATAAAGGTAATTTGCATTCAATTTATATTTAAA
ATTTGTTACTTTTTTAGAAGAGTATTTTGGTTTTTTAATTATAATAAATCCCATTTTCAA
ACGATGCAGAAAAAAAAAAAATTTTATAATTTTTGTTTAAAGTTTTTGATAAATTTATTT
GATGTAAGCACAGCAAAAATAGATTATTTTAAATCATTCAGAATCAAATCTTTGAAAAAG
GGAAATTAGATGATAAAAATGCTTCAAAAATTAAAAGACTTCCAAAAATATTTAAAATAA
TTTAGGTTAATGAAAAGATGAGATAAATGGATAAAGAATTAACAAGAAGTCATTTGCAAA
AATCTTTATTTGTATTGAGCACTGTACCTTTACAAGGCTATATTATGGGTAGACTTGAGC
CTACCACTAAGGCCTACTTTGATTAAGAAAATATAACAGACTATGAAATACTCAAATGTG
CTTATGATAATATGAATTTAACTCTTAAAAATAATTAAAATATTTAAGAAAGTGAGATAT
ATATTGGCACCTCATTAAAGACTATGATTCACTTCTTTAAAGAAAAGACTTTAGTTATTT
TAAAAGCTTTATTACTTTAAAAAAAAATTTTGGTTTACTCACTGCACAGCTGCTCTACCA
GTAATTTTGTAATGAGTTTGATTAGCTTAATACCCGGTCTTTCATTTTTCAAGTTCAAAA
GTAAATATATAGATATAATATAAAGTGCTCTTGGTGAGTATGGATTACCTTTAAGAGTTT
TTAATGAGCAAGACTGTCCTTTGGAATTATACTTTACGATCTAATAATTAGATAATATGG
ATAAATATAAAGGTTACCTTATAGGTACTACAAACTAGTTAATAAGGTCTCATAAAAAAA
CTGGAGCTGATTTAATAGTTGATTTGGATACAAACTAACTCATCATCTAAAATGAAGCTA
TAAAGACATCTCTTTAACTAAATTCTGAAGAAAAAAAATTTATGGAAGGTATCACTAAAA
CAGTCAATAAAGTAGTTAGTGAAAGTGATAAAAACTGGAAAAATATGGAATACAGTTAAA
ACGATAGCTCATTTATTGGTAGTAATGATTGGATTAGATAACAGTTCACTAAATACATCA
TAGATTTGCTTTGTGAGATAGAACTTGTAAAAAAAAGGTAATAATATAATTTACTATCAA
AACAATATCAAATAGATTAATAATTTAATTGATTAATTTACCTCACTAAAATAAAAAAAG
ATAAACTTTTTTTAATTTGATGACTGTATAAGATATTTTTTTATAATTAATTTCTAATTA
TTGCTCATTAAAAAAATGTCATGTTGATAAATTATTTCAAAAATAAAATAAGATTAAAAT
AAATAATTTTTAATTAATTATTTTGAAAATAAATTTATTGGAGAATATTAACTCTTCTTT
TTCTAAATTAAAATACACTTTTTATTTAATATTAGGTATAGAGATTTCTAAGATGAAATA
TCAAATAGACTAAAAAGAAAATCAAGCTTAGGAAAAAAAGATGATGCAAGAATTAACCAA
AAGTTAGATAAATTAGAGAATAACTTAAGTCACAGAAAAGTAAATTTAAAGATTAGATTA
CATTTTTAGTTAATTTATTACAAATAAATAGGAAAAAGATGAATTTTAAATAGAATCAGG
TAATCAAGATCATTAAATTCAATAATCTTAGTCAACTACTGCTTCAACTATTTCAGATTT
AGATAGTAAATAAGAAATTACTTAAAAAAGGAAAGTCAGTAATCTCTCAGAAAAAAGCTA
AAACAGCAATGATGAAGAAATAATAAATGAGTTATTTGATGATTTTTTAAATTTTGACTC
TGATGAAGAAGAATAGTAAGCAAGTTACGGTCAGCAATCAAATAAATATGCTAAATTTAA
TTAGCTTGATGGAGACACTCTATTAGCTTTTAACATAGATTCAGAAGTATCCAAAACAGA
AAAAATTTTTAAGCAAAAGAAAAAACAGTTGAAAATTAGTTATGCAACTTTAAAGAAATA
CAATTTTAAATTTTTGAAAGAATTCTTTCTAACTGAAAATTATAAGTACTGGTTACTTCA
TCACGATGATTAAATATATTTACGTAGTATCAATTGTTCAGAGTTGACTTAAAGGTCTTG
CATTACTCTTGAAAGTGGCTAAATATTCTTTGGTTCAATGTAAAATGGGGAAAGAAACGG
AAAAGGTTTTTTGAAATTTTGATCTTAGAAGTAAATTTTTATTTTATAATAAATATAAAA
ATAGGTACAACATTTGATTAGATTTAAGGAAAGATTGAGCAATGTGAAAATTATGAAAAT
GATATGAAAAATGGAAAAACTACAATTGTAACCTTAAAAAACGACTATTACTTTGAAGGA
GATTTTATTGATGATTAGAAGCAAGGTTTTGGAAACTTAGTCACAGATAAATTGAAATAT
TGTGGTTCTTTTAATTTAGACAAGTTTAATGGTTAAGGAACTTTAGTAGATAAAGATTAA
AGCTTATATGAAGGAGAGTTCTAAAATAACATGAAAAATGGAATGGGCAAATATAGAAGT
GGAGATAGCTCTATCAATTACGTTGGTTAATTTATTGACGATCTTTTTTCTGATAAAGGT
TAGCTTGTGAAATCTAATGGTGATGTTTACTGTGGAGATTTTAAAAAAGGGTAAATGCAT
GGTCAAGGTGAATATTAAAGTGAAGGTTATTCATATACTGGAGAATTCTTGCATAACAAA
TTTAATGGCTAAGGATTTTATAAAGACCTAAAAACAAATAACATTTATTAAGGAGAGTTT
GTTGAAAATCAGCTTGATCCTGAACAATAACATATCATTAAATATCATAATGGAGATGTC
TACAGTGGATTTATTAAAGATTGGTAACCTAATGGAGAAGGACTTATTTGTTACAAAGAT
GGAAAAATAGTAAAAGGAATTTTCGAAAGTGGAATAATAAAATAATAATTTGAGTGA