Identifiers and Description

Gene Model Identifier

TTHERM_00729130

Standard Name

MRNC25 (Membrane Occupation and Recognition Nexus protein C-terminal)

Aliases

PreTt07314 | 118.m00142 | 3739.m00064

Description

protein with predicted MORN domains localized at the C-terminus of the protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.3%

TetraMine Data

TTHERM_00729130

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_17972.19.997093137033517e-262hypothetical protein (513 aa)
OxytrichaContig13677.0.1.g351.9994498063102785e-22MORN repeat
Stentor CoeruleusSteCoe_233750.00000000003775134544279098
WormBaseWBGene000021790.000030009396760408108locus:jph-1 status:Confirmed
UniProt:Q22667 protein_id
:CAA99924.2

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00729130(coding)
ATGTTTGAATCTGTTGAAGAGTAGTTGCTCGAAAGAGAAATGATGAAAATTATCAAGTAG
TTTTAACTAAATATTGATATCGAAAAAAATCAAGAAGTGAAAGTATAAAATGGCCAAAAG
GATAAGGAAATAAACATAAAATCACAGAATAAAGAAGTAGAAAAAGTAAATAAGGCAGTT
GGAGATGAAGAAATAGATTGGGAATAAAACTATTTAGATTTAATGTAAGAATGTGGTTAT
TAATTACCAGATGAAGAAATTAATACCCAACTTGACAACGAAAATGAAAAAAAAATTAAT
TTGATGATATAAAAAAATGATGAATGCCATAATAGGGATTTTGCATAATATAAATTGTAG
CCTATAAATAATGAGAGTGATGATTAAGAAAGCGAAGAAGTCTAAAAATCAAAATAGATG
ATGAATGACCTTCATGATGAAGAAGAATAAATTATGACTCCAGAACAATAAAAGGAGTAT
TTTAAATCATTACGCAGTAAATACTTAAATGTAAAATAAGTAGATGAGTAAAAGTAAACA
GAAAAATCAGTTGATACAACTGCTTATGCAACAAATGAATCTGATACCACTTAAATAAGT
AGCTAAAATGTAGCTAATAATTAAAAATAATAGCCTTTATTAGAGGAAAAATAACTTGAA
TAGACTTAAAATGATGATTAAGGATAATTAAAATAAAATGATAGCAGTTAAATTTAAAAA
TAAAATGAAAATAGTCAAAGCATAGATAAGCCTAGAAGTTTATTGCCATAAGATCACGTT
ACTTTAACAAGAGAAATGTATGATGAATAGAAAAAGCAATAAAAAGCTCTAAAAAAGGCA
ATTCAAAATGCTAAAGATTTAGGTATAGTTTACAATGGAGTAATTAACTTTGAAAATTTC
GATGAGACTAGCAGTGAAGAAGGAGAAGATTAAAATAAGCTTTAAGATTAAGAATAAGAT
GAATAATTAGAAGACAATAATGTCATAGAAGAGTAGGATGAAGATGAATATGATGAAAAC
AATGACTAAACAACTTAAGATGAACAAGTAAATGTCTTGACTGAAATAAAAAGAGAATAT
ATTTAGACTAATAAATGGAATTGTAAAGAATATAAGATATTTTACTCAAACGAGGACATA
TACGAAGGTGAGATAGATGATAAAACATCTCTTAAAGATGGTTGGGGTGTTTACTTATAT
GCGAACGGTGAAAAATATGAAGGGTTCTTCTAAGATGATATTATCCATGGATATGGAAGA
TATTAATTTTTAGGAGGACATAAGTATGAAGGCGATTGGAGTTAAGGTATGAAACATGGT
GTGGGAATTCTTGAATTTGCTTCAGGAGATAAGTATATAGGATTTTTTGAGCGTGATAAT
TTCCATGGATAAGGTGAATACTTTTACAAGAATGGAGATAAGTTTGAAGGTACATTCGTA
CATGGAAAAAAAAATGGCACCGGTAAATTTTTAGGAGCTAATGGAAGAAAAATAATAGGA
GAATGGATTGATGATCAACTTTAACATTTTTGA


>TTHERM_00729130(protein)
MFESVEEQLLEREMMKIIKQFQLNIDIEKNQEVKVQNGQKDKEINIKSQNKEVEKVNKAV
GDEEIDWEQNYLDLMQECGYQLPDEEINTQLDNENEKKINLMIQKNDECHNRDFAQYKLQ
PINNESDDQESEEVQKSKQMMNDLHDEEEQIMTPEQQKEYFKSLRSKYLNVKQVDEQKQT
EKSVDTTAYATNESDTTQISSQNVANNQKQQPLLEEKQLEQTQNDDQGQLKQNDSSQIQK
QNENSQSIDKPRSLLPQDHVTLTREMYDEQKKQQKALKKAIQNAKDLGIVYNGVINFENF
DETSSEEGEDQNKLQDQEQDEQLEDNNVIEEQDEDEYDENNDQTTQDEQVNVLTEIKREY
IQTNKWNCKEYKIFYSNEDIYEGEIDDKTSLKDGWGVYLYANGEKYEGFFQDDIIHGYGR
YQFLGGHKYEGDWSQGMKHGVGILEFASGDKYIGFFERDNFHGQGEYFYKNGDKFEGTFV
HGKKNGTGKFLGANGRKIIGEWIDDQLQHF


>TTHERM_00729130(gene)
ATGTTTGAATCTGTTGAAGAGTAGTTGCTCGAAAGAGAAATGATGAAAATTATCAAGTAG
TTTTAACTAAATATTGATATCGAAAAAAATCAAGAAGTAATAGATTACAACAGTTATTTT
TATTTAGTTAACTTTAATGCTTATAAATTATTTCAATCATTTTATTTACAGGTGAAAGTA
TAAAATGGCCAAAAGGATAAGGAAATAAACATAAAATCACAGAATAAAGTAAATAAACAT
TTGAGATATACTTTTACTTAAGCTCAAATATTAAAAAAGGAAGTAGAAAAAGTAAATAAG
GCAGTTGGAGATGAAGAAATAGATTGGGAATAAAACTATTTAGATTTAATGTAAGAATGT
GGTTATTAATTACCAGATGAAGAAATTAATACCCAACTTGACAACGAAAATGAAAAAAAA
ATTAATTTGATGATATAAAAAAATGATGAATGCCATAATAGGGATTTTGCATAATATAAA
TTGTAGCCTATAAATAATGAGAGTGATGATTAAGAAAGCGAAGAAGTCTAAAAATCAAAA
TAGATGATGAATGACCTTCATGATGAAGAAGAATAAATTATGACTCCAGAACAATAAAAG
GAGTATTTTAAATCATTACGCAGTAAATACTTAAATGTAAAATAAGTAGATGAGTAAAAG
TAAACAGAAAAATCAGTTGATACAACTGCTTATGCAACAAATGAATCTGATACCACTTAA
ATAAGTAGCTAAAATGTAGCTAATAATTAAAAATAATAGCCTTTATTAGAGGAAAAATAA
CTTGAATAGACTTAAAATGATGATTAAGGATAATTAAAATAAAATGATAGCAGTTAAATT
TAAAAATAAAATGAAAATAGTCAAAGCATAGATAAGCCTAGAAGTTTATTGCCATAAGAT
CACGTTACTTTAACAAGAGAAATGTATGATGAATAGAAAAAGCAATAAAAAGCTCTAAAA
AAGGCAATTCAAAATGCTAAAGATTTAGGTATAGTTTACAATGGAGTAATTAACTTTGAA
AATTTCGATGAGACTAGCAGTGAAGAAGGAGAAGATTAAAATAAGCTTTAAGATTAAGAA
TAAGATGAATAATTAGAAGACAATAATGTCATAGAAGAGTAGGATGAAGATGAATATGAT
GTATTGATTATTAAATTTTATATTTCTATTTGAAATAAAAATAAATTAAAAAAATAAATA
AATGAAGGAAAACAATGACTAAACAACTTAAGATGAACAAGTAAATGTCTTGACTGAAAT
AAAAAGAGAATATATTTAGACTAATAAATGGAATTGTAAAGAATATAAGATATTTTACTC
AAACGAGGACATATACGAAGGTGAGATAGATGATAAAACATCTCTTAAAGATGGTTGGGG
TGTTTACTTATATGCGAACGGTGAAAAATATGAAGGGTTCTTCTAAGATGATATTATCCA
TGGATATGGAAGATATTAGTAAATTTAACAAATTATAATCGAATTTTATCACTTTTTTAT
TTATCAGATTTTTAGGAGGACATAAGTATGAAGGCGATTGGAGTTAAGGTATGAAACATG
GTGTGGGAATTCTTGAATTTGCTTCAGGAGATAAGTATATAGGATTTTTTGAGCGTGATA
ATTTCCATGGATAAGGTAGAATTGAATTTTCAAAAAGCTTATATAATTTAAATAAATTAA
TAAAAGGTGAATACTTTTACAAGAATGGAGATAAGTTTGAAGGTACATTCGTACATGGAA
AAAAAAATGGCACCGGTAAATTTTTAGGAGCTAATGGAAGAAAAATAATAGGAGAATGGA
TTGATGATCAACTTTAACATTTTTGA