Identifiers and Description

Gene Model Identifier

TTHERM_00196110

Standard Name

MRNC22 (Membrane Occupation and Recognition Nexus protein C-terminal)

Aliases

PreTt06796 | 16.m00452

Description

protein with predicted MORN domains localized at the C-terminus of the protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 9.7%

TetraMine Data

TTHERM_00196110

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_03791.19.997093137033517e-262hypothetical protein (871 aa)
OxytrichaContig1068.0.0.g830.000000000000001999258566166494MORN repeat

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00196110(coding)
ATGACAAATCGTGTCAACTACCTTTATTCTGATTACAAGGGATATGGCTTGTAATAAGGA
ATTTCTTTGACAGCATAAAAAAATGGCGCAATCACTTAAACATCTAGCTTTAACTACTAA
CCTGTTGCAAAAGAAAATATATCAACATTAGGCTAAATTTCTAATTAACCTTTGTACTAA
TAAATTTAATACTCAACATAATCAGGTCGCACAGTTCAAAGGACTGCTTCACCAATGATT
ATTCAGCATCCTAGTAGATATGGAACAAATAATGCAAATTTAAGCACCTCACCAAATCAG
TCTAGTGCAACTAGTGCAACGAAATATTAAGTTCCTTCTTACTAGAATAATGGCGGTTTA
TCAACTAATTTTTCATATTCTGCAGAAAAAAGCACAACCTCTAATGGAACAGAAGCTATA
TCTCGTCCTTCTATAGGAGCTTCATATCTTTCATCCTAAAACAATAACTAATTTAATAAT
AGTTAAGCACTTCGTTCTCCATATGTCTCTAGTTTTACTTCTAATTTGACATCCAGTTAA
ATGAATGGTACTTCCAATTCTAACTCTAATCCTAGCGGAGCGTAAGTTACCCATCATCAT
GGAAGATCAATAAGTATGTTTTCAGGCTAAAATTATACAGCTCCTTCTATAGCCTAGAGC
TTATCTCTTTCCATTGGAACTTAATCAAATTAACCATCATCAACTAATTAGTCTTCATTA
GCAAGTGGAAATGTAGCAAATCTAGGTAATAATTAAAATAACTCTACTTCATTTTCATAA
GTTTATACCTCACTATCAGCAAACAATAAAGTAGCCTTGAATAATAATTTAAGCAGTGGT
GTAAATGGATAAATTGTTGGTGATAGAAGTATAAGCTATACAGGAAGCAGTGCCTATCCT
CAAATAAATACATAAAGTATAGAAAATTTTTACTAGCAGAATAGCTAGCCTTCAAATGAG
TAACTTAACAGATCAGATTCATTATCTCCAAGTAAGCGTGTTACTTTTAATTTAGCTCGT
AATACTTACACAGATATAGAGTAAATTGAAAAGCGTTTAAATGAGTCTACTAGATTAAGA
CCTGCAGATGAAGTAGAAGACAGTAGAGATAGAACCCCAACAGCAACCTTTGGCCATAAC
CATATATATGAAGATGATTTGAGCAAGAGATTCGATTAAGCTATTTTCCGCAGTGAGAGA
ATCATTTCTGATTGCCTTCGCATTGGAAGAGAAGGTCAGCAATACAAAAATGCATTAGAA
AATAGCACAGTAGCAAATGGATCTACAACACCAAATGGTCCAAAAATGATCCGCAATCCA
AGTAGAAGTAAAAGTCCAATAAAATCAAGCTTAAAGAGAACTTCTAGTTTTACTGGTAGT
CCTTAAAAATCTGTAAACACTACTCCTAGCACTTATTAAGCTGCATAAGATACTAATTTA
GCTGCTTCTTAAAATTTGTAGAAATTTAGTGATGCCTTTGAAAATCCACTAACAAACCAA
ACTAATAAAATTATCAACAATATTCATACAACAACTGAGACTATTTATTCCTCCAAATAA
GCAGCTTCACCATATCTTTAGAGTAATTCTTCATCAGAAAAGACTCCATAATCTTTAACT
AATAATTCAGCTTCAACTGTGGTTTCTTCAACAAACTCATCTCAGATTTCTGTTCCCTCT
TACTTGGCCTAAACTTCATCCTTGAATAGCCAAAATCCCGAAAAACAAGTACCTTTATCA
AGCTAAACCACATATGTCTCTTCTTCAACAAAATAAGTTGGACTTACTAATTCAGTCACT
GATGAAAATCAATTTGTAGCATCCTCATCTAATGTAAATAAAGCTATTACTTCATCTAAG
CCTTACAGTGCACAAGAAAATGGAATTTCTTCAAGCGTGTACTCTGTGACTTCAGCATAT
AATACATCTCTATTATCTTCTACATAAAATACAAACCCATAAAAAGCATCTTATCTATCA
AAAGTTTCATCATCAAAAGAAAATGAGCAATAAAGTGTCTCAAGTTAAAATAAAGCTCCA
TCTTAAGTAGAATTTACCTCTATTGCTTTAAAAAAGAGTGAATCTGAGGTAGTAGATTAA
AATCAAAATAAACAAGATAAATAATAAAATGATGCAAAGAGATTAAGCTTGCAACCAACT
TCTGCTACAAAGCCTCGCCAAGGTATCTTAAGATATTCAGATGGATCCAGATATGATGGA
GAAATCTTAAATAATTAAAGACATGGGTACGGTACTTTGCTTAGTAGTGATTTCTAAGTT
ATTTATTAAGGAGATTGGTAAAATGATACCTATCATGGATAAGGTAAATTCTTCAATCCC
TTAGCAGAAAACCTCTTTGATGAATATGAATATAGTGATTTTGATGTTGCTTTGAGTCAA
TACTGGGAATCATATGAAGGAGAATTTTATGAAGGTAAATTAGATGGTTTTGGAACTTTG
ATGCTTACAAATGGTGAAAAGCTAGTAGGAAATTTCAAAAAAGGTCGTATCTGTGGAAAA
GGAACCTTTTACTGCAATAAAGGACCAGCCGTTACAGGTAACTGGGAAGACAATCGCTTA
TTAGAAAAGTATTGA


>TTHERM_00196110(protein)
MTNRVNYLYSDYKGYGLQQGISLTAQKNGAITQTSSFNYQPVAKENISTLGQISNQPLYQ
QIQYSTQSGRTVQRTASPMIIQHPSRYGTNNANLSTSPNQSSATSATKYQVPSYQNNGGL
STNFSYSAEKSTTSNGTEAISRPSIGASYLSSQNNNQFNNSQALRSPYVSSFTSNLTSSQ
MNGTSNSNSNPSGAQVTHHHGRSISMFSGQNYTAPSIAQSLSLSIGTQSNQPSSTNQSSL
ASGNVANLGNNQNNSTSFSQVYTSLSANNKVALNNNLSSGVNGQIVGDRSISYTGSSAYP
QINTQSIENFYQQNSQPSNEQLNRSDSLSPSKRVTFNLARNTYTDIEQIEKRLNESTRLR
PADEVEDSRDRTPTATFGHNHIYEDDLSKRFDQAIFRSERIISDCLRIGREGQQYKNALE
NSTVANGSTTPNGPKMIRNPSRSKSPIKSSLKRTSSFTGSPQKSVNTTPSTYQAAQDTNL
AASQNLQKFSDAFENPLTNQTNKIINNIHTTTETIYSSKQAASPYLQSNSSSEKTPQSLT
NNSASTVVSSTNSSQISVPSYLAQTSSLNSQNPEKQVPLSSQTTYVSSSTKQVGLTNSVT
DENQFVASSSNVNKAITSSKPYSAQENGISSSVYSVTSAYNTSLLSSTQNTNPQKASYLS
KVSSSKENEQQSVSSQNKAPSQVEFTSIALKKSESEVVDQNQNKQDKQQNDAKRLSLQPT
SATKPRQGILRYSDGSRYDGEILNNQRHGYGTLLSSDFQVIYQGDWQNDTYHGQGKFFNP
LAENLFDEYEYSDFDVALSQYWESYEGEFYEGKLDGFGTLMLTNGEKLVGNFKKGRICGK
GTFYCNKGPAVTGNWEDNRLLEKY


>TTHERM_00196110(gene)
ATGACAAATCGTGTCAACTACCTTTATTCTGATTACAAGGGATATGGCTTGTAATAAGGA
ATTTCTTTGACAGCATAAAAAAATGGTAAACTTATTCATTTGAAAAATTATCACCAATTA
AATTTTTATTTAAAAAAGGCGCAATCACTTAAACATCTAGCTTTAACTACTAACCTGTTG
CAAAAGAAAATATATCAACATTAGGCTAAATTTCTAATTAACCTTTGTACTAATAAATTT
AATACTCAACATAATCAGGTCGCACAGTTCAAAGGACTGCTTCACCAATGATTATTCAGC
ATCCTAGTAGATATGGAACAAATAATGCAAATTTAAGCACCTCACCAAATCAGTCTAGTG
CAACTAGTGCAACGAAATATTAAGTTCCTTCTTACTAGAATAATGGCGGTTTATCAACTA
ATTTTTCATATTCTGCAGAAAAAAGCACAACCTCTAATGGAACAGAAGCTATATCTCGTC
CTTCTATAGGAGCTTCATATCTTTCATCCTAAAACAATAACTAATTTAATAATAGTTAAG
CACTTCGTTCTCCATATGTCTCTAGTTTTACTTCTAATTTGACATCCAGTTAAATGAATG
GTACTTCCAATTCTAACTCTAATCCTAGCGGAGCGTAAGTTACCCATCATCATGGAAGAT
CAATAAGTATGTTTTCAGGCTAAAATTATACAGCTCCTTCTATAGCCTAGAGCTTATCTC
TTTCCATTGGAACTTAATCAAATTAACCATCATCAACTAATTAGTCTTCATTAGCAAGTG
GAAATGTAGCAAATCTAGGTAATAATTAAAATAACTCTACTTCATTTTCATAAGTTTATA
CCTCACTATCAGCAAACAATAAAGTAGCCTTGAATAATAATTTAAGCAGTGGTGTAAATG
GATAAATTGTTGGTGATAGAAGTATAAGCTATACAGGAAGCAGTGCCTATCCTCAAATAA
ATACATAAAGTATAGAAAATTTTTACTAGCAGAATAGCTAGCCTTCAAATGAGTAACTTA
ACAGATCAGATTCATTATCTCCAAGTAAGCGTGTTACTTTTAATTTAGCTCGTAATACTT
ACACAGATATAGAGTAAATTGAAAAGCGTTTAAATGAGTCTACTAGATTAAGACCTGCAG
ATGAAGTAGAAGACAGTAGAGATAGAACCCCAACAGCAACCTTTGGCCATAACCATATAT
ATGAAGATGATTTGAGCAAGAGATTCGATTAAGCTATTTTCCGCAGTGAGAGAATCATTT
CTGATTGCCTTCGCATTGGAAGAGAAGGTCAGCAATACAAAAATGCATTAGAAAATAGCA
CAGTAGCAAATGGATCTACAACACCAAATGGTCCAAAAATGATCCGCAATCCAAGTAGAA
GTAAAAGTCCAATAAAATCAAGCTTAAAGAGAACTTCTAGTTTTACTGGTAGTCCTTAAA
AATCTGTAAACACTACTCCTAGCACTTATTAAGCTGCATAAGATACTAATTTAGCTGCTT
CTTAAAATTTGTAGAAATTTAGTGATGCCTTTGAAAATCCACTAACAAACCAAACTAATA
AAATTATCAACAATATTCATACAACAACTGAGACTATTTATTCCTCCAAATAAGCAGCTT
CACCATATCTTTAGAGTAATTCTTCATCAGAAAAGACTCCATAATCTTTAACTAATAATT
CAGCTTCAACTGTGGTTTCTTCAACAAACTCATCTCAGATTTCTGTTCCCTCTTACTTGG
CCTAAACTTCATCCTTGAATAGCCAAAATCCCGAAAAACAAGTACCTTTATCAAGCTAAA
CCACATATGTCTCTTCTTCAACAAAATAAGTTGGACTTACTAATTCAGTCACTGATGAAA
ATCAATTTGTAGCATCCTCATCTAATGTAAATAAAGCTATTACTTCATCTAAGCCTTACA
GTGCACAAGAAAATGGAATTTCTTCAAGCGTGTACTCTGTGACTTCAGCATATAATACAT
CTCTATTATCTTCTACATAAAATACAAACCCATAAAAAGCATCTTATCTATCAAAAGTTT
CATCATCAAAAGAAAATGAGCAATAAAGTGTCTCAAGTTAAAATAAAGCTCCATCTTAAG
TAGAATTTACCTCTATTGCTTTAAAAAAGAGTGAATCTGAGGTAGTAGATTAAAATCAAA
ATAAACAAGATAAATAATAAAATGATGCAAAGAGATTAAGCTTGCAACCAACTTCTGCTA
CAAAGCCTCGCCAAGGTATCTTAAGATATTCAGATGGATCCAGATATGATGGAGAAATCT
TAAATAATTAAAGACATGGGTACGGTACTTTGCTTAGTAGTGATTTCTAAGTTATTTATT
AAGGAGATTGGTAAAATGATACCTATCATGGATAAGGTAAATTCTTCAATCCCTTAGCAG
AAAACCTCTTTGATGAATATGAATATAGTGATTTTGATGTTGCTTTGAGTCAATACTGGG
AATCATATGAAGGAGAATTTTATGAAGGTAAATTAGATGGTTTTGGAACTTTGATGCTTA
CAAATGGTGAAAAGCTAGTAGGAAATTTCAAAAAAGGTCGTATCTGTGGAAAAGGAACCT
TTTACTGCAATAAAGGACCAGCCGTTACAGGTAACTGGGAAGACAATCGCTTATTAGAAA
AGTATTGA