Identifiers and Description

Gene Model Identifier

TTHERM_00149910

Standard Name

MRNC18 (Membrane Occupation and Recognition Nexus protein C-terminal)

Aliases

PreTt20751 | 12.m00425 | 3700.m00146

Description

protein with predicted MORN domains localized at the C-terminus of the protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF02493 ) MORN repeat
  • ( PF00643 ) B-box zinc finger
  • ( PF07661 ) MORN repeat variant
  • ( PF00473 ) Corticotropin-releasing factor family
  • ( TIGR00042 ) non-canonical purine NTP pyrophosphatase, rdgB/HAM1

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.4%

TetraMine Data

TTHERM_00149910

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_05054.19.997093137033517e-262hypothetical protein (747 aa)
OxytrichaContig14161.0.g644.0009493637353324e-18MORN repeat
DictyBaseDDB_G03494880.0000000039998859049333245DDB_G0349488 on chromosome: 2
position 6912714 to 6914186

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00149910(coding)
ATGAGTCAGCAATCATAAGTTTCTAACAAAAATAATTTTAGAAGGAGAACAATAAATAGC
TAATAACTCGAATTTTAGTCTCCTGAAAAAGAATCGAATGCCAATGATTAACCTAAATTA
TCTTAGGATTCAATATGTGAGTAATAAGAATAATAGATATCAGTAAACTTATCCATTGAC
AATTCTTTGCAGAGCAATTCATAAAAAGATGATTAAGGGATAATAACACCTAAAAAAGAT
AAAATTTTAGTTCAGTCTTTTACTGACGCATTGATACAGCAAAACAACTAGTAAAATAAT
AAATAGTTAATATCAAAGAATTTTCTTTCTCCTACTTCATCATAATCTAGCAATAAATCA
AGGAGTTCTTTATCATCACCAATATAAATTAGAATAAATCCTAATTAATACTAAATATCT
AACAATACTGCTCGTCGCAGTTTAAATTATGAAATTAGCTAAATTTAAGAAAAGAGGCTA
GAGGATGAAAAAACAGCCATATCTTATGCTGAAAAAGTTTTATAAAGTAGAAACTTTTTA
AGCCAATAAAAGAGCAAGCAAGAAAATTAAAGATATTCTTTGTTTGTAACAACAGCTTAA
CAAGCTGGAGTATACGTAGGTAAAGAAGGGTAATAATAGGGGATTTTAAAAAAAAAGACG
AATAATAACTATTTTACTAATACAAACTAATTATTCAATACCTAAAACTAGCTCACCTTC
ATTGCTGATAAAACAAAATCTGTAGAATTAAATGAAAATAATATCTAACAAGATGAAAAA
AACAACCTTAATAATTCCAGTAGTAAAATTAATAAAATTTTACTTCCAGACAGAAGTGAA
ATCACAAACAAAATAAATGGTGCTGAAATAAATCAATTTGTAGCTTCAGACAACAAAAAA
GTAAATTTTTAGACATTATCCTAATAGCCAGCTTCTTCAAAAGTAAGAAGTAGGAAAGTG
GGAAGCAGTAGCTTAAATAATGAGGTTATCAGTGGTAAAGAAATTTCAATTCTAGATAAA
AAAGCTCTCACAAAAATAACAAAAGTAAACACTGAAAGAAACAGTATTATTTAACCTGAG
AGAAGTATGGATGATCATTATAATAAATTGCCACGTTGCTATGAGCATTCAAAAAGAATT
AAAGAACTGTATTGTGTAGATGATAATTGTTAAGTGAAAAATAAATTTGGATGTGTTCTC
TGTTTTAGCTCTGTCAACGGATCACCTCACAGTTTCCATGAATATTACACAATTTCCTCA
GAAGAAGATTTACAAGCTAAAATAAATAGAAATAGATAAGATTTTATTCAATTTATTTAA
GATAAGATTCAATTCAAGTGCCAAGATAAGAAATCTTAATTTTATATGTATTAAGATTAA
ATCACAGAATCTTTAATTAATTATGCTGATTCTATACAGGATAGGCTATTTATAGGATTT
GAGGCAGAAGAAATACAAAAATTTTAGCTCCCTCTTTTGTAGGGAAGTATTGAAAGAAAG
AGTCCAGCAAAAAAATCAAAGCGAAATTCTAAAGAAAATAGGGAAGAATTCGATGAAAAA
GAATTATCAATAATCTTGTACATAGACCTACTTGAGAAATAATTGAATAAAAAAATAGAA
AATTAGAATAAAATATGGCTACAACAAATCTATCTTGGTGAAAAAAATGAAGAATTTTTA
AAGGAAAAGAAATGTAAATTAATTATAGCTGGTAAATGCTTTAGCAATCTTAGTGATCAA
ATATTAAAATTATACTTAACTAGTGAGCAGGTTAATTATGATTTATAAGAACTAGAAAAC
AACAAATCATAGCTGTATTATATAAATGATGAAAATAGTGATGGTATTTATTAATTAGAT
GATGATAAAGTAAAATAAGGAAGAGGAATTTAATTTTTTAAGAGTGGAGGTTTATATGAA
GGGTATTTTAAAAATAATTAAAAGCATGGAAAAGGGAAACTAATTACATTTGAAGGAGAT
GTTTACATAGGAGAATTTCAAAAAAACATGAAAAGAGGAAGAGGTGTATTAACCTACTCG
AATAAAGATATATATGATGGAGAATTTTATTAAGACACATGTCACGGAATTGGAAAAATG
AGTTATGCTAAAGACTAAGTTGTATATATAGGTGGATGGAATAAAAATTAAAGGCATGGA
AAAGGATAAATTTTTAAAGACAATGAACTAATATTCTCAGGCGTATATATAGGAGACAAC
CCTAAGGCTAATAGTAAAGAATGA


>TTHERM_00149910(protein)
MSQQSQVSNKNNFRRRTINSQQLEFQSPEKESNANDQPKLSQDSICEQQEQQISVNLSID
NSLQSNSQKDDQGIITPKKDKILVQSFTDALIQQNNQQNNKQLISKNFLSPTSSQSSNKS
RSSLSSPIQIRINPNQYQISNNTARRSLNYEISQIQEKRLEDEKTAISYAEKVLQSRNFL
SQQKSKQENQRYSLFVTTAQQAGVYVGKEGQQQGILKKKTNNNYFTNTNQLFNTQNQLTF
IADKTKSVELNENNIQQDEKNNLNNSSSKINKILLPDRSEITNKINGAEINQFVASDNKK
VNFQTLSQQPASSKVRSRKVGSSSLNNEVISGKEISILDKKALTKITKVNTERNSIIQPE
RSMDDHYNKLPRCYEHSKRIKELYCVDDNCQVKNKFGCVLCFSSVNGSPHSFHEYYTISS
EEDLQAKINRNRQDFIQFIQDKIQFKCQDKKSQFYMYQDQITESLINYADSIQDRLFIGF
EAEEIQKFQLPLLQGSIERKSPAKKSKRNSKENREEFDEKELSIILYIDLLEKQLNKKIE
NQNKIWLQQIYLGEKNEEFLKEKKCKLIIAGKCFSNLSDQILKLYLTSEQVNYDLQELEN
NKSQLYYINDENSDGIYQLDDDKVKQGRGIQFFKSGGLYEGYFKNNQKHGKGKLITFEGD
VYIGEFQKNMKRGRGVLTYSNKDIYDGEFYQDTCHGIGKMSYAKDQVVYIGGWNKNQRHG
KGQIFKDNELIFSGVYIGDNPKANSKE


>TTHERM_00149910(gene)
ATGAGTCAGCAATCATAAGTTTCTAACAAAAATAATTTTAGAAGGAGAACAATAAATAGC
TAATAACTCGAATTTTAGTCTCCTGAAAAAGAATCGAATGCCAATGATTAACCTAAATTA
TCTTAGGATTCAATATGTGAGTAATAAGAATAATAGATATCAGTAAACTTATCCATTGAC
AATTCTTTGCAGAGCAATTCATAAAAAGATGATTAAGGGATAATAACACCTAAAAAAGAT
AAAATTTTAGTTCAGTCTTTTACTGACGCATTGATACAGCAAAACAACTAGTAAAATAAT
AAATAGTTAATATCAAAGAATTTTCTTTCTCCTACTTCATCATAATCTAGCAATAAATCA
AGGAGTTCTTTATCATCACCAATATAAATTAGAATAAATCCTAATTAATACTAAATATCT
AACAATACTGCTCGTCGCAGTTTAAATTATGAAATTAGCTAAATTTAAGAAAAGAGGCTA
GAGGATGAAAAAACAGCCATATCTTATGCTGAAAAAGTTTTATAAAGTAGAAACTTTTTA
AGCCAATAAAAGAGCAAGCAAGAAAATTAAAGATATTCTTTGTTTGTAACAACAGCTTAA
CAAGCTGGAGTATACGTAGGTAAAGAAGGGTAATAATAGGGGATTTTAAAAAAAAAGACG
AATAATAACTATTTTACTAATACAAACTAATTATTCAATACCTAAAACTAGCTCACCTTC
ATTGCTGATAAAACAAAATCTGTAGAATTAAATGAAAATAATATCTAACAAGATGAAAAA
AACAACCTTAATAATTCCAGTAGTAAAATTAATAAAATTTTACTTCCAGACAGAAGTGAA
ATCACAAACAAAATAAATGGTGCTGAAATAAATCAATTTGTAGCTTCAGACAACAAAAAA
GTAAATTTTTAGACATTATCCTAATAGCCAGCTTCTTCAAAAGTAAGAAGTAGGAAAGTG
GGAAGCAGTAGCTTAAATAATGAGGTTATCAGTGGTAAAGAAATTTCAATTCTAGATAAA
AAAGCTCTCACAAAAATAACAAAAGTAAACACTGAAAGAAACAGTATTATTTAACCTGAG
AGAAGTATGGATGATCATTATAATAAATTGCCACGTTGCTATGAGCATTCAAAAAGAATT
AAAGAACTGTATTGTGTAGATGATAATTGTTAAGTGAAAAATAAATTTGGATGTGTTCTC
TGTTTTAGCTCTGTCAACGGATCACCTCACAGTTTCCATGAATATTACACAATTTCCTCA
GAAGAAGATTTACAAGCTAAAATAAATAGAAATAGATAAGATTTTATTCAATTTATTTAA
GATAAGATTCAATTCAAGTGCCAAGATAAGAAATCTTAATTTTATATGTATTAAGATTAA
ATCACAGAATCTTTAATTAATTATGCTGATTCTATACAGGATAGGCTATTTATAGGATTT
GAGGCAGAAGAAATACAAAAATTTTAGCTCCCTCTTTTGTAGGGAAGTATTGAAAGAAAG
AGTCCAGCAAAAAAATCAAAGCGAAATTCTAAAGAAAATAGGGAAGAATTCGATGAAAAA
GAATTATCAATAATCTTGTACATAGACCTACTTGAGAAATAATTGAATAAAAAAATAGAA
AATTAGAATAAAATATGGCTACAACAAATCTATCTTGGTGAAAAAAATGAAGAATTTTTA
AAGGAAAAGAAATGTAAATTAATTATAGCTGGTAAATGCTTTAGCAATCTTAGTGATCAA
ATATTAAAATTATACTTAACTAGTGAGCAGGTTAATTATGATTTATAAGAACTAGAAAAC
AACAAATCATAGCTGTATTATATAAATGATGAAAATAGTGATGGTATTTATTAATTAGAT
GATGATAAAGTAAAATAAGGAAGAGGAATTTAATTTTTTAAGAGTGGAGGTTTATATGAA
GGGTATTTTAAAAATAATTAAAAGCATGGAAAAGGGAAACTAATTACATTTGAAGGAGAT
GTTTACATAGGAGAATTTCAAAAAAACATGAAAAGAGGAAGAGGTGTATTAACCTACTCG
AATAAAGATATATATGATGGAGAATTTTATTAAGACACATGTCACGGAATTGGAAAAATG
AGTTATGCTAAAGACTAAGTTGTATATATAGGTGGATGGAATAAAAATTAAAGGCATGGA
AAAGGATAAATTTTTAAAGACAATGAACTAATATTCTCAGGCGTATATATAGGAGACAAC
CCTAAGGCTAATAGTAAAGAATGA