Identifiers and Description

Gene Model Identifier

TTHERM_00277360

Standard Name

MRNC14 (Membrane Occupation and Recognition Nexus protein C-terminal)

Aliases

PreTt04779 | 25.m00243 | 3694.m00030

Description

protein with predicted MORN domains localized at the C-terminus of the protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00277360

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_08893.11.0001999920370885e-161hypothetical protein (368 aa)
OxytrichaContig17269.0.g783.0007793728221555e-22MORN repeat
DictyBaseDDB_G03494880.000000100009565553302DDB_G0349488 on chromosome: 2
position 6912714 to 6914186

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00277360(coding)
ATGGGTATAGTTAATTCATGTGAGAAATCTACAAGACAAGTCGATAATGAAGTCTATTTG
AACGCGACTGGCGGAAGTCAATGTAGCAATAGAAAAACTCTTTAGCAGACCAGCACACTC
TAAACTCAAGGTTAAAACAAAGAAAATCAAGCTAAATAACCAACTAATAAGTCAAACTCT
TACCTTAAGTAGCATTAGGAAAATATTTCGCCAATATAAGAATTAACAACAGAAGAATCA
AAGAATAGCAAGTCTGCTTATTCTAAAATGTTTGACAAAGGATTAATTGAAAGCAACGCT
TTAAAAGTTCTAAAAATTGAATAAAATGAAACAAAATTACTCAACTCGATGTACTCAAAT
AATCTTTTGAATTCAACTGCTCTATATGACTGCTAAAGAAATAGATCATCATATTCTTAA
CATGTTGTAGGAAGTGTCTAGAGCAATTTACTATAACAGAATAACTCATATATGAATTGC
AGTCAGGCACAATTTATTGAAAAAGAAGGTATTAAATCAAGTAGACCTTCTCTCAATTAA
TAGAGTATGACAAGATCAACACATTCTACTTCCCTTTATGTTGCAAATGAGAGGAAGAGA
GTCAAAGAGATATACGAAGATGGTTCTGTCTATGAAGGTCAAGTATTAAATGGATTGAGG
GATGGGTAAGGCACATTCACTTACTCAAATTAAGGAGCTAAGTATGTAGGCTAATGGCTT
AAAGGTAACATCGAAGGATATGGCATACTTTTTTTCTCTGACAACAGAGTTGCATACGAA
GGCCAATGGAGAGAAAATAAATTCAATGGGAACGGAGTCGTATACAATGAAAACCATTCA
AAAAGGTAAAGTAAAATAGTTGGTTTCGACTATAAAAGTTTTGACAATATTGAAGAAGAA
TGGTTTAAGTATGATGGAAACTTTGTAGATGATCAAAAAGATGGACTTGGAACTCTATAC
CTAAAAAACGGTGAGAAATTTGTGGGAAACTTCCACAAAGATGCTGTGAATGGCAATGGA
GCATTTTATTTGATTGACGGTACAATAATCTTAGGAGTTTGGGACAATAATAATTTAGTT
CAAGAAACAACAAGAATTAAAAGTTGTTGA


>TTHERM_00277360(protein)
MGIVNSCEKSTRQVDNEVYLNATGGSQCSNRKTLQQTSTLQTQGQNKENQAKQPTNKSNS
YLKQHQENISPIQELTTEESKNSKSAYSKMFDKGLIESNALKVLKIEQNETKLLNSMYSN
NLLNSTALYDCQRNRSSYSQHVVGSVQSNLLQQNNSYMNCSQAQFIEKEGIKSSRPSLNQ
QSMTRSTHSTSLYVANERKRVKEIYEDGSVYEGQVLNGLRDGQGTFTYSNQGAKYVGQWL
KGNIEGYGILFFSDNRVAYEGQWRENKFNGNGVVYNENHSKRQSKIVGFDYKSFDNIEEE
WFKYDGNFVDDQKDGLGTLYLKNGEKFVGNFHKDAVNGNGAFYLIDGTIILGVWDNNNLV
QETTRIKSC


>TTHERM_00277360(gene)
ATGGGTATAGTTAATTCATGTGAGAAATCTACAAGACAAGTCGATAATGAAGTCTATTTG
AACGCGACTGGCGGAAGTCAATGTAGCAATAGAAAAACTCTTTAGCAGACCAGCACACTC
TAAACTCAAGGTTAAAACAAAGAAAATCAAGCTAAATAACCAACTAATAAGTCAAACTCT
TACCTTAAGTAGCATTAGGAAAATATTTCGCCAATATAAGAATTAACAACAGAAGAATCA
AAGAATAGCAAGTCTGCTTATTCTAAAATGTTTGACAAAGGATTAATTGAAAGCAACGCT
TTAAAAGTTCTAAAAATTGAATAAAATGAAACAAAATTACTCAACTCGATGTACTCAAAT
AATCTTTTGAATTCAACTGCTCTATATGACTGCTAAAGAAATAGATCATCATATTCTTAG
TAATATATATTTATTCTACCAGTTTTATAAAACCAAATGCATTGTTTTTTAATAAATAAA
TTTTTTAAAAACCACCTGAAAAAAATAGACATGTTGTAGGAAGTGTCTAGAGCAATTTAC
TATAACAGAATAACTCATATATGAATTGCAGTCAGGCACAATTTATTGAAAAAGAAGGTA
TTAAATCAAGTAGACCTTCTCTCAATTAATAGAGTATGACAAGATCAACACATTCTACTT
CCCTTTATGTTGCAAATGAGAGGAAGAGAGTCAAAGAGATATACGAAGATGGTTCTGTCT
ATGAAGGTCAAGTATTAAATGGATTGAGGGATGGGTAAGGCACATTCACTTACTCAAATT
AAGGAGCTAAGTATGTAGGCTAATGGCTTAAAGGTAACATCGAAGGATATGGCATACTTT
TTTTCTCTGACAACAGAGTTGCATACGAAGGCCAATGGAGAGAAAATAAATTCAATGGGA
ACGGAGTCGTATACAATGAAAACCATTCAAAAAGGTAAAGTAAAATAGTTGGTTTCGACT
ATAAAAGTTTTGACAATATTGAAGAAGAATGGTTTAAGTATGATGGAAACTTTGTAGATG
ATCAAAAAGATGGACTTGGAACTCTATACCTAAAAAACGGTGAGAAATTTGTGGGAAACT
TCCACAAAGATGCTGTGAATGGCAATGGAGCATTTTATTTGATTGACGGTACAATAATCT
TAGGAGTTTGGGACAATAATAATTTAGTTCAAGAAACAACAAGAATTAAAAGTTGTTGA