Identifiers and Description

Gene Model Identifier

TTHERM_00437420

Standard Name

MRNC13 (Membrane Occupation and Recognition Nexus protein C-terminal)

Aliases

PreTt05398 | 49.m00170 | 3708.m00020

Description

protein with predicted MORN domains localized at the C-terminus of the protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00437420

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_12485.19.997093137033517e-262hypothetical protein (350 aa)
OxytrichaContig18845.0.g1040.000000000000001999258566166494MORN repeat
DictyBaseDDB_G03494880.000005000363240844623DDB_G0349488 on chromosome: 2
position 6912714 to 6914186

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00437420(coding)
ATGGGATAAGAAGCAAGCTGCTGCAAATAAAAGCACGCTGATATAGGAATCGAAAGAATA
TTTGATAACAACTATCAAATTAATAGAGAAACCATATAAATACTAGGAGCTGATACTAAT
CATTTCAATCCTTACCGTAAATCCAAGTTGATAAAGCTTCATAAAGTTTAATGTGAGGAA
AATTAAGCAAAGCCTGAGAGCGCAAAAGGCAATTCTATTTACCATTCCAGAAATTGGTCA
ACCGCTTCATAGACACTTTAGGAATCTAACTTTTAGCGTTCTGGTGACAACAACCAAATT
CGTTCATCTTTTGATGTAAAAGGAAACAATGTGAATGGAACTAACTAATATTATTCAAAC
AATACCTAATACAACTCAACTCAAGAGACTTTAAATAATTTCTCTTCATAGCCCTCCATA
TCAAATAATTAATACGGATCATTTTAGGGAAATTACGTAACTTCTCCAAGTTCTTATGAG
TTAGACAATTTTTAATAAGTCGCAGGTGTTCATAACAATAACACATTTGCTGCAGTTGTC
AACTCAGATTAAGTCTATTCAGTTCGTGAAACATACCTTGATGGATCTACCTATGAAGGA
GAAAAAGTTGGTGAATTCCGTTAAGGATATGGAATTTTTATTTTCTCAAATAAGGCATGC
TACAAAGGAAACTGGAGCCAAGACAAAATGAACGGAAGAGGATTGCTATATTATTCAAGT
GGTTAGCTTGCTTACTAAGGTCAATTTGCTGAAAATAAATTTTAAGGATATGGCTATTTG
AACAATGAAATAATTGACTACACCCTTAGAGAGGATGATGACAAATATTACCACGATTTT
AGTACTATCGGAAATAAATGGATCAAGTATGAAGGAGAATTCTACAATGATGCAAAAAAT
GGAAGAGGCAGACTTTACTTTTCCAATGGTGACTTTATACAAGCAGACTTTGTAGAAGAT
AAAATTAATGGAGAATGCATTCTATATAAATCAAATAACTAAATAGTGAAGGGGTATTGG
AGAGAAAATAAGCTCATAAGAATTACCTACTGA


>TTHERM_00437420(protein)
MGQEASCCKQKHADIGIERIFDNNYQINRETIQILGADTNHFNPYRKSKLIKLHKVQCEE
NQAKPESAKGNSIYHSRNWSTASQTLQESNFQRSGDNNQIRSSFDVKGNNVNGTNQYYSN
NTQYNSTQETLNNFSSQPSISNNQYGSFQGNYVTSPSSYELDNFQQVAGVHNNNTFAAVV
NSDQVYSVRETYLDGSTYEGEKVGEFRQGYGIFIFSNKACYKGNWSQDKMNGRGLLYYSS
GQLAYQGQFAENKFQGYGYLNNEIIDYTLREDDDKYYHDFSTIGNKWIKYEGEFYNDAKN
GRGRLYFSNGDFIQADFVEDKINGECILYKSNNQIVKGYWRENKLIRITY


>TTHERM_00437420(gene)
ATGGGATAAGAAGCAAGCTGCTGCAAATAAAAGCACGCTGATATAGGAATCGAAAGAATA
TTTGATAACAACTATCAAATTAATAGAGAAACCATATAAATACTAGGAGCTGATACTAAT
CATTTCAATCCTTACCGTAAATCCAAGTTGATAAAGCTTCATAAAGTTTAATGTGAGGAA
AATTAAGCAAAGCCTGAGAGCGCAAAAGGCAATTCTATTTACCATTCCAGAAATTGGTCA
ACCGCTTCATAGACACTTTAGGAATCTAACTTTTAGCGTTCTGGTGACAACAACCAAATT
CGTTCATCTTTTGATGTAAAAGGAAACAATGTGAATGGAACTAACTAATATTATTCAAAC
AATACCTAATACAACTCAACTCAAGAGACTTTAAATAATTTCTCTTCATAGCCCTCCATA
TCAAATAATTAATACGGATCATTTTAGGGAAATTACGTAACTTCTCCAAGTTCTTATGAG
TTAGACAATTTTTAATAAGTCGCAGGTGTTCATAACAATAACACATTTGCTGCAGTTGTC
AACTCAGATTAAGTCTATTCAGTTCGTGAAACATACCTTGATGGATCTACCTATGAAGGA
GAAAAAGTTGGTGAATTCCGTTAAGGATATGGAATTTTTATTTTCTCAAATAAGGCATGC
TACAAAGGAAACTGGAGCCAAGACAAAATGAACGGAAGAGGGTAAATATTATTTTTACTT
AAATTTATATGAAAAGAAAAATATTAGATATTCAAGCATTGAATATTAATTATAATTGGA
CACTATTAATTTTAAAGGTTAAAAATGTAAGATTATATCTATGAATAAAAAACTGTTAAA
ATAATTTTCTTACTTGAAGCAACCTCGAAGCTAACAAAATATTTAGTTAGTAGAAAAATC
AAACAATAGCAAAATAAATCTACTTTACTTAACTTACCATTTATTTTTCTTAAATTAATT
TTGAAATGAAAGAAAACTAGAAAATAGACAAATTAATTAATTTTTCAATCTTAAGAAAAA
AATATGAAAATCAAGAAGAAATAAATAAATAAATTATAAATTTAAAAAAGATCTTTTAAG
ATTAACTCAAATAACGCAAAAAACTAAAATAATAAATTAATAGTTTCATTTAACTTTTCT
TAATTTTTAGCTATTTCAAACCCTTAAATAACTTATATTATTTAAAATAGATTGCTATAT
TATTCAAGTGGTTAGCTTGCTTACTAAGGTCAATTTGCTGAAAATAAATTTTAAGGATAT
GGCTATTTGAACAATGAAATAATTGACTACACCCTTAGAGAGGATGATGACAAATATTAC
CACGATTTTAGTACTATCGGAAATAAATGGATCAAGTATGAAGGAGAATTCTACAATGAT
GCAAAAAATGGAAGAGGCAGACTTTACTTTTCCAATGGTGACTTTATACAAGCAGACTTT
GTAGAAGATAAAATTAATGGAGAATGCATTCTATATAAATCAAATAACTAAATAGTGAAG
GGGTATTGGAGAGAAAATAAGCTCATAAGAATTACCTACTGA