Identifiers and Description

Gene Model Identifier

TTHERM_00037070

Standard Name

MRNC11 (Membrane Occupation and Recognition Nexus protein C-terminal)

Aliases

PreTt14442 | 2.m02210 | 3825.m02814

Description

protein with predicted MORN domains localized at the C-terminus of the protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.4%

TetraMine Data

TTHERM_00037070

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_11200.16.0002282540086176e-27hypothetical protein (491 aa)
OxytrichaContig12162.0.g873.999672240330216e-26MORN repeat
Stentor CoeruleusSteCoe_366860.0000000000006914400106940203
WormBaseWBGene000021790.000000009996807949091551locus:jph-1 status:Confirmed
UniProt:Q22667 protein_id
:CAA99924.2
DictyBaseDDB_G03494880.000000019990673443141236DDB_G0349488 on chromosome: 2
position 6912714 to 6914186

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00037070(coding)
ATGCAAATGGAAACTTCAATTAATAATTCTATGGACCTTGGAAGAGGTTTAGTAACAGAT
TAATCAGAAATATAGTTATCTGATATGAAAAGAACATAAAAAGAAAGTGATTAAAATAAG
GCCTTAAAGAATGGTTAATGGGTTTACAATTTCAATAATGGAGACAAGTATGATGGAGAA
TGGAATAATGATTAAATGGATGGAGTTGGCAAACTTTAGTATAAAGATGGTTCTGTATTT
GAAGGAAGATTTTCTAAAAATAAGCGTAGTGGTTATGGTGTCTATCGCTTTTCTAATGGT
AATTACTACGAAGGTTAATGGTAAGATGGACATCAAGAAGGATTTGGTGTTTTTAAGTTT
TTTAATGGTGAGAAATATGAAGGGTAGTTTAAAGAAGGAATGTTTGATGGCCAAGGAATT
TACTACTACAAATCAGGAAATAAATATGTTGGAAATTGGAAAACTGATAAATGGCATGGA
GAAGGAGAGTATTATTTTAATAGTAATGGTGACAAAAAAAAGGGAACTTTTGATTAAGAT
GTTCTAATAGGCTAATTTACTTATTACTATAAAGACGGTAGAGTTGAACAAAAAGATAAT
TGA


>TTHERM_00037070(protein)
MQMETSINNSMDLGRGLVTDQSEIQLSDMKRTQKESDQNKALKNGQWVYNFNNGDKYDGE
WNNDQMDGVGKLQYKDGSVFEGRFSKNKRSGYGVYRFSNGNYYEGQWQDGHQEGFGVFKF
FNGEKYEGQFKEGMFDGQGIYYYKSGNKYVGNWKTDKWHGEGEYYFNSNGDKKKGTFDQD
VLIGQFTYYYKDGRVEQKDN


>TTHERM_00037070(gene)
TTTGATATAATTTAAATATTAAAATACTAAATTATTAAAAATAATAACAATAAACAAGTA
ATTAAATATATAAGCATGCAAATGGAAACTTCAATTAATAATTCTATGGACCTTGGAAGA
GGTTTAGTAACAGATTAATCAGAAATATAGTTATCTGATATGAAAAGAACATAAAAAGAA
AGTGATTAAAATAAGGCCTTAAAGAATGGTTAATGGGTTTACAATTTCAATAATGGAGAC
AAGTATGATGGAGAATGGAATAATGATTAAATGGATGGAGTTGGCAAACTTTAGTATAAA
GATGGTTCTGTATTTGAAGGAAGATTTTCTAAAAATAAGCGTAGTGGTTATGGTGTCTAT
CGCTTTTCTAATGGTAATTACTACGAAGGTTAATGGTAAGATGGACATCAAGAAGGATTT
GGTGTTTTTAAGTTTTTTAATGGTGAGAAATATGAAGGGTAGTTTAAAGAAGGAATGTTT
GATGGCCAAGGAATTTACTACTACAAATCAGGAAATAAATATGTTGGAAATTGGAAAACT
GATAAATGGCATGGAGAAGGAGAGTATTATTTTAATAGTAATGGTGACAAAAAAAAGGGA
ACTTTTGATTAAGATGTTCTAATAGGCTAATTTACTTATTACTATAAAGACGGTAGAGTT
GAACAAAAAGATAATTGA