Identifiers and Description

Gene Model Identifier

TTHERM_00037070

Standard Name

MRNC11 (Membrane Occupation and Recognition Nexus protein C-terminal)

Aliases

PreTt14442 | 2.m02210 | 3825.m02814

Description

phosphatidylinositol 4-phosphate 5-kinase

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.4%

TetraMine Data

TTHERM_00037070

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_11200.16.0002282540086176e-27hypothetical protein (491 aa)
OxytrichaContig12162.0.g873.999672240330216e-26MORN repeat
Stentor CoeruleusSteCoe_366860.0000000000006914400106940203
WormBaseWBGene000021790.000000009996807949091551locus:jph-1 status:Confirmed
UniProt:Q22667 protein_id
:CAA99924.2
DictyBaseDDB_G03494880.000000019990673443141236DDB_G0349488 on chromosome: 2
position 6912714 to 6914186

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00037070(coding)
ATGCAAATGGAAACTTCAATTAATAATTCTATGGACCTTGGAAGAGGTTTAGTAACAGAT
TAATCAGAAATATAGTTATCTGATATGAAAAGAACATAAAAAGAAAGTGATTAAAATAAG
GCCTTAAAGAATGGTTAATGGGTTTACAATTTCAATAATGGAGACAAGTATGATGGAGAA
TGGAATAATGATTAAATGGATGGAGTTGGCAAACTTTAGTATAAAGATGGTTCTGTATTT
GAAGGAAGATTTTCTAAAAATAAGCGTAGTGGTTATGGTGTCTATCGCTTTTCTAATGGT
AATTACTACGAAGGTTAATGGTAAGATGGACATCAAGAAGGATTTGGTGTTTTTAAGTTT
TTTAATGGTGAGAAATATGAAGGGTAGTTTAAAGAAGGAATGTTTGATGGCCAAGGAATT
TACTACTACAAATCAGGAAATAAATATGTTGGAAATTGGAAAACTGATAAATGGCATGGA
GAAGGAGAGTATTATTTTAATAGTAATGGTGACAAAAAAAAGGGAACTTTTGATTAAGAT
GTTCTAATAGGCTAATTTACTTATTACTATAAAGACGGTAGAGTTGAACAAAAAGATAAT
TGA


>TTHERM_00037070(protein)
MQMETSINNSMDLGRGLVTDQSEIQLSDMKRTQKESDQNKALKNGQWVYNFNNGDKYDGE
WNNDQMDGVGKLQYKDGSVFEGRFSKNKRSGYGVYRFSNGNYYEGQWQDGHQEGFGVFKF
FNGEKYEGQFKEGMFDGQGIYYYKSGNKYVGNWKTDKWHGEGEYYFNSNGDKKKGTFDQD
VLIGQFTYYYKDGRVEQKDN


>TTHERM_00037070(gene)
ATGCAAATGGAAACTTCAATTAATAATTCTATGGACCTTGGAAGAGGTTTAGTAACAGAT
TAATCAGAAATATAGTTATCTGATATGAAAAGAACATAAAAAGAAAGTGATTAAAATAAG
GCCTTAAAGAATGGTTAATGGGTTTACAATTTCAATAATGGAGACAAGTATGATGGAGAA
TGGAATAATGATTAAATGGATGGAGTTGGCAAACTTTAGTATAAAGATGGTTCTGTATTT
GAAGGAAGATTTTCTAAAAATAAGCGTAGTGGTTATGGTGTCTATCGCTTTTCTAATGGT
AATTACTACGAAGGTTAATGGTAAGATGGACATCAAGAAGGATTTGGTGTTTTTAAGTTT
TTTAATGGTGAGAAATATGAAGGGTAGTTTAAAGAAGGAATGTTTGATGGCCAAGGAATT
TACTACTACAAATCAGGAAATAAATATGTTGGAAATTGGAAAACTGATAAATGGCATGGA
GAAGGAGAGTATTATTTTAATAGTAATGGTGACAAAAAAAAGGGAACTTTTGATTAAGAT
GTTCTAATAGGCTAATTTACTTATTACTATAAAGACGGTAGAGTTGAACAAAAAGATAAT
TGA