Identifiers and Description

Gene Model Identifier

TTHERM_00297110

Standard Name

MRNC10 (Membrane Occupation and Recognition Nexus protein C-terminal)

Aliases

PreTt15722 | 27.m00382 | 3692.m00184

Description

protein with predicted MORN domains localized at the C-terminus of the protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00297110

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_08863.19.997093137033517e-262hypothetical protein (1798 aa)
OxytrichaContig11701.0.g70.000000009996807949091551MORN repeat

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00297110(coding)
ATGTAAACATAGATTTATCAATAACAAATTCCTGCTTTATAGCAGTAGCAGCAATTTGTG
AGCATACCTTTACAGGCACATGATTAGTTTGGAAAAAGTTTATAAAAAGGCTTCTCTACA
ACTTAAATTCATAAAGCCCCGCTTCCTCCTAAATTAGGAAAACCTAATAAAAATATGATA
GAATAAAATAATGATGCATTAATATCTAATGGACAATTTAGAATAGGAAATTAATAAGCT
TTGAATGATAATAAATATTTTGAAATCAAATACACTAATCAGGAACCAAGTAATCATGTT
AATTAGTATCATTGGGAATAAAATTACAATTAAAATGTCAATTAAGAAAATTTATTAACT
AAATATTCCTAAGCAAATTCGCAAATCAGATCATCAAACTATATTAGCAATCCATATGTG
ATTACTTCAAGTAATATATAAATATTACCAATAAGTATAGAAAAAGTAAATTCAGTTAAA
GGTTTGATTCAATCAGAAAGTATTAGCACTCCTATATACCAACCTGAATAAAATATTTCA
CCCATATCTAAAATGAGCTTAACTAATAATTAAATGCCTTAACAACAAAATATAGACTTC
TAAGCAGGTTAATATTTATAAAACTTATAGGATCAAATGAAAAATTAAATATAACCAATC
AGATAGGAAGAAATCAATACTTAATAGGATAAACTCAAACGCAGCTATAGTGAGTATTTA
CCTAAAAAGGAAAATAATTTAAATGAATTCAAATAATTTTAAATTTATCTTAGTAAGGTA
ACTATTGATCCAAATGATTACCTTAATTTTTAAACAAGTAATATCAGTGAGAATATAAAG
GAAAGCTCCTAAGAAAGTGAATTAAAAATAGACTTAAAGTATACTAATTATATAGATGGA
GGTGGTAGTCCCTTTACCTTAAATAAGAATCCATAAAAACCTAATTTTTTTAAAACTTAT
GAATAATTATAAAAATAAGATGAAAGTTAAAAGGGAGTTCAGTCTTTTCAAAAATAAAGT
TAAGAATACTAAAAATAGTATAATGAAAATGAAAAAATATTATAACCTCCTAGAAAAACA
TCTGTTTAATGCTAAAGATTAAAGGATAATAACACAGTTACGATTTTGGAGATTGAAGAT
TATGGTAATTACTAAAGTGAAGCTCAAAATTAAGAAAATTAAAAACAAGAAAACAATATA
TAAGGTGTTTAATAGAAGAACTTTTATAATACCACAAATCTAGAAAAATTTGAAAGCTTT
GGAAAATTGAACTTTGATAATGAGGGAACCAATCAACCTGATTAATAGGTTAAATATATT
TCTAATGATATTCCAAATTATAATTCAATAGTTAATTATAATAGTAACGGTAATTAAGAT
AGTTTAATTGCTCCTTAAAATAATAATCTTCAACTACCTTAAGGACTAAACTTATTAAGC
AGTATCAATAGCAACATAACTGGTAATGAATAAAGTCCTTTTTGCAGCTCTTTCATTAGA
TAAAGCGATTTGATAAGGAAAAGAATGAATAGCACTGATGATCCATAGGTTTTTTTTAAC
TAAACAAATTTACATAATTTATTTTCAAATCCAAGCTCAACTAAGAATGCTAGAAGCGAA
AGTAATGCTATAAACATTATTGAAACACATTCAATAAATAATTATAACTCATAACCTCAA
AGCTAGTTGCAAGGCTAAAAGCAAGCATAGTCTAATAGTATCTAAGAAACAAATGAAGAA
TATACTGAAAGTATTGTTATAGATTAAATTAAGAATTTTAATTAAAAATCCATAAAAGAT
ACTAATAATAGTAATAAAATTAAATAAGATTTAAATAGGCCTTCTTTGCCTAAGCCTTTA
ACAAATAAAGAACAGTCTTTATTCAAAAGCAAAAGTACTGAAAATATATCATAAAATAAT
AATTATAACTTATCTTAAAATGATAATAAGAGTTATTACTTATAAAAGGCTGAGCAGATT
TTAAAACAGCTCGGGCAGAATCCTTCTTTTTCAAATAATACTAATATCACAATATCTTCA
CAAAATATAGCTAATCCAAATTTGTATTTAACAATTGATGAAAAATAAAGCAATTTGACA
AACAACATGTAAAATTCAGTAAATTAGGTAAAATTACTTCCTAAATAAGAAAATACAACA
AATTTAATAGATTCTTCTTCATGCACAACTGAGAGAAGAAAGAAAAATATTAATTAAATA
GTCTAAAAATGTGTTGAAAGGACATAAAACTTAATTGAAAAACTAAAATCTAAATCTAAA
AAGTAGCAACTATAAAAGTATACAAATATCCTAAACTAAGCTTAGGAAAGTCCTAAAAAA
ATAGAAAAAAGTAAAAAACATGAAGAAATAAGATAAAGCAGACAAAAAGTAGATGAATTA
GTGAATGAAGCACTTTATCGCTCAAGGTAGGTAATCTAAAGACATTTTTAGAGCAAAAAT
TTAGCTGGTTCTCCACCGGCTTAAACATATGATTAAGATGAGTAATAAGATTATTAGGAT
AACTAAGTAAATTACAATACAAATTATTAATTCTAGCATACTCAATTGAACTATGACTAA
AATAGCGCATAATCTAAGGATAATAACACATTTGGGTATTCCTCGAATTAAAATAAAGAA
CCTCTATCTCCGAACACAAATTTATAATTTCAGTAAAATAATCTTTCAGATCCTTATCAG
CAAATGGACTATTAAATCAGAATTACTCCAATAGGATCTGATTAAAAATCCCCATTATAA
AATGAAGATCATTAATTGAATAGTTTTAGTAAAGAAAATAATTCTATCAGCTTTGACATA
CAAGCAGGAAATTCAGGGAAATCAAATTAATTAACAAGCTAGGAAAACTTATCACCTTTC
AAACAAAATTTGTAATCTTTTGGTTCTAGCAATAAATAAAAAGAGGAATCTACCTATATA
AATAATAGGCAGCAGAAATAAATAGCTTATGAGAATTCAAATCAAAATTTTATTTTTGAA
GGAGTTCTAGACGCTAATGGAAAAAAGTAAGGCTATGGAATTTTAAGGAATAAATAAAAT
CAAATGGTCATATATGAAGGAGAATGGGTAAATGATCTTTTTGATGGATAAGGTATTTTA
TATAATTAATTTCCTGAAAATTTATAGAATTCTTTCAGCTATAGTGATTTTAATAAAATA
TCTAATTATTGGAAAGTTTATGAAGGAGAATTCTAATTAGGATTAAAAAATGGTTCAGGT
ACCCTAGTTTTTACAAACGAAGAAAAGTATAGCGGCAAGTTTATAAATGATAAAGTTAAT
GGAGAAGGTGTTTTTTATTCAAATGATAGCAAAAAGCAACCAATAGTAGGATTATGGGTA
AATAATATCTTATCAAAAATATTATGA


>TTHERM_00297110(protein)
MQTQIYQQQIPALQQQQQFVSIPLQAHDQFGKSLQKGFSTTQIHKAPLPPKLGKPNKNMI
EQNNDALISNGQFRIGNQQALNDNKYFEIKYTNQEPSNHVNQYHWEQNYNQNVNQENLLT
KYSQANSQIRSSNYISNPYVITSSNIQILPISIEKVNSVKGLIQSESISTPIYQPEQNIS
PISKMSLTNNQMPQQQNIDFQAGQYLQNLQDQMKNQIQPIRQEEINTQQDKLKRSYSEYL
PKKENNLNEFKQFQIYLSKVTIDPNDYLNFQTSNISENIKESSQESELKIDLKYTNYIDG
GGSPFTLNKNPQKPNFFKTYEQLQKQDESQKGVQSFQKQSQEYQKQYNENEKILQPPRKT
SVQCQRLKDNNTVTILEIEDYGNYQSEAQNQENQKQENNIQGVQQKNFYNTTNLEKFESF
GKLNFDNEGTNQPDQQVKYISNDIPNYNSIVNYNSNGNQDSLIAPQNNNLQLPQGLNLLS
SINSNITGNEQSPFCSSFIRQSDLIRKRMNSTDDPQVFFNQTNLHNLFSNPSSTKNARSE
SNAINIIETHSINNYNSQPQSQLQGQKQAQSNSIQETNEEYTESIVIDQIKNFNQKSIKD
TNNSNKIKQDLNRPSLPKPLTNKEQSLFKSKSTENISQNNNYNLSQNDNKSYYLQKAEQI
LKQLGQNPSFSNNTNITISSQNIANPNLYLTIDEKQSNLTNNMQNSVNQVKLLPKQENTT
NLIDSSSCTTERRKKNINQIVQKCVERTQNLIEKLKSKSKKQQLQKYTNILNQAQESPKK
IEKSKKHEEIRQSRQKVDELVNEALYRSRQVIQRHFQSKNLAGSPPAQTYDQDEQQDYQD
NQVNYNTNYQFQHTQLNYDQNSAQSKDNNTFGYSSNQNKEPLSPNTNLQFQQNNLSDPYQ
QMDYQIRITPIGSDQKSPLQNEDHQLNSFSKENNSISFDIQAGNSGKSNQLTSQENLSPF
KQNLQSFGSSNKQKEESTYINNRQQKQIAYENSNQNFIFEGVLDANGKKQGYGILRNKQN
QMVIYEGEWVNDLFDGQGILYNQFPENLQNSFSYSDFNKISNYWKVYEGEFQLGLKNGSG
TLVFTNEEKYSGKFINDKVNGEGVFYSNDSKKQPIVGLWVNNILSKIL


>TTHERM_00297110(gene)
TTTGATAATTCATTCATTCTAAATATTTTTAACAATCAATTAAACATTTTTAATTAATTA
ATTAGAAAAATGTAAACATAGATTTATCAATAACAAATTCCTGCTTTATAGCAGTAGCAG
CAATTTGTGAGCATACCTTTACAGGCACATGATTAGTTTGGAAAAAGTTTATAAAAAGGC
TTCTCTACAACTTAAATTCATAAAGCCCCGCTTCCTCCTAAATTAGGAAAACCTAATAAA
AATATGATAGAATAAAATAATGATGCATTAATATCTAATGGACAATTTAGAATAGGAAAT
TAATAAGCTTTGAATGATAATAAATATTTTGAAATCAAATACACTAATCAGGAACCAAGT
AATCATGTTAATTAGTATCATTGGGAATAAAATTACAATTAAAATGTCAATTAAGAAAAT
TTATTAACTAAATATTCCTAAGCAAATTCGCAAATCAGATCATCAAACTATATTAGCAAT
CCATATGTGATTACTTCAAGTAATATATAAATATTACCAATAAGTATAGAAAAAGTAAAT
TCAGTTAAAGGTTTGATTCAATCAGAAAGTATTAGCACTCCTATATACCAACCTGAATAA
AATATTTCACCCATATCTAAAATGAGCTTAACTAATAATTAAATGCCTTAACAACAAAAT
ATAGACTTCTAAGCAGGTTAATATTTATAAAACTTATAGGATCAAATGAAAAATTAAATA
TAACCAATCAGATAGGAAGAAATCAATACTTAATAGGATAAACTCAAACGCAGCTATAGT
GAGTATTTACCTAAAAAGGAAAATAATTTAAATGAATTCAAATAATTTTAAATTTATCTT
AGTAAGGTAACTATTGATCCAAATGATTACCTTAATTTTTAAACAAGTAATATCAGTGAG
AATATAAAGGAAAGCTCCTAAGAAAGTGAATTAAAAATAGACTTAAAGTATACTAATTAT
ATAGATGGAGGTGGTAGTCCCTTTACCTTAAATAAGAATCCATAAAAACCTAATTTTTTT
AAAACTTATGAATAATTATAAAAATAAGATGAAAGTTAAAAGGGAGTTCAGTCTTTTCAA
AAATAAAGTTAAGAATACTAAAAATAGTATAATGAAAATGAAAAAATATTATAACCTCCT
AGAAAAACATCTGTTTAATGCTAAAGATTAAAGGATAATAACACAGTTACGATTTTGGAG
ATTGAAGATTATGGTAATTACTAAAGTGAAGCTCAAAATTAAGAAAATTAAAAACAAGAA
AACAATATATAAGGTGTTTAATAGAAGAACTTTTATAATACCACAAATCTAGAAAAATTT
GAAAGCTTTGGAAAATTGAACTTTGATAATGAGGGAACCAATCAACCTGATTAATAGGTT
AAATATATTTCTAATGATATTCCAAATTATAATTCAATAGTTAATTATAATAGTAACGGT
AATTAAGATAGTTTAATTGCTCCTTAAAATAATAATCTTCAACTACCTTAAGGACTAAAC
TTATTAAGCAGTATCAATAGCAACATAACTGGTAATGAATAAAGTCCTTTTTGCAGCTCT
TTCATTAGATAAAGCGATTTGATAAGGAAAAGAATGAATAGCACTGATGATCCATAGGTT
TTTTTTAACTAAACAAATTTACATAATTTATTTTCAAATCCAAGCTCAACTAAGAATGCT
AGAAGCGAAAGTAATGCTATAAACATTATTGAAACACATTCAATAAATAATTATAACTCA
TAACCTCAAAGCTAGTTGCAAGGCTAAAAGCAAGCATAGTCTAATAGTATCTAAGAAACA
AATGAAGAATATACTGAAAGTATTGTTATAGATTAAATTAAGAATTTTAATTAAAAATCC
ATAAAAGATACTAATAATAGTAATAAAATTAAATAAGATTTAAATAGGCCTTCTTTGCCT
AAGCCTTTAACAAATAAAGAACAGTCTTTATTCAAAAGCAAAAGTACTGAAAATATATCA
TAAAATAATAATTATAACTTATCTTAAAATGATAATAAGAGTTATTACTTATAAAAGGCT
GAGCAGATTTTAAAACAGCTCGGGCAGAATCCTTCTTTTTCAAATAATACTAATATCACA
ATATCTTCACAAAATATAGCTAATCCAAATTTGTATTTAACAATTGATGAAAAATAAAGC
AATTTGACAAACAACATGTAAAATTCAGTAAATTAGGTAAAATTACTTCCTAAATAAGAA
AATACAACAAATTTAATAGATTCTTCTTCATGCACAACTGAGAGAAGAAAGAAAAATATT
AATTAAATAGTCTAAAAATGTGTTGAAAGGACATAAAACTTAATTGAAAAACTAAAATCT
AAATCTAAAAAGTAGCAACTATAAAAGTATACAAATATCCTAAACTAAGCTTAGGAAAGT
CCTAAAAAAATAGAAAAAAGTAAAAAACATGAAGAAATAAGATAAAGCAGACAAAAAGTA
GATGAATTAGTGAATGAAGCACTTTATCGCTCAAGGTAGGTAATCTAAAGACATTTTTAG
AGCAAAAATTTAGCTGGTTCTCCACCGGCTTAAACATATGATTAAGATGAGTAATAAGAT
TATTAGGATAACTAAGTAAATTACAATACAAATTATTAATTCTAGCATACTCAATTGAAC
TATGACTAAAATAGCGCATAATCTAAGGATAATAACACATTTGGGTATTCCTCGAATTAA
AATAAAGAACCTCTATCTCCGAACACAAATTTATAATTTCAGTAAAATAATCTTTCAGAT
CCTTATCAGCAAATGGACTATTAAATCAGAATTACTCCAATAGGATCTGATTAAAAGTAA
ATGTTTTTATTTGCTATTAATATTTTTAAAATAAAAAATAACATTAATTCTATAAAACTA
GATCCCCATTATAAAATGAAGATCATTAATTGAATAGTTTTAGTAAAGAAAATAATTCTA
TCAGCTTTGACATACAAGCAGGAAATTCAGGGAAATCAAATTAATTAACAAGCTAGGAAA
ACTTATCACCTTTCAAACAAAATTTGTAATCTTTTGGTTCTAGCAATAAATAAAAAGAGG
AATCTACCTATATAAATAATAGGCAGCAGAAATAAATAGCTTATGAGAATTCAAATCAAA
ATTTTATTTTTGAAGGAGTTCTAGACGCTAATGGAAAAAAGTAAGGCTATGGAATTTTAA
GGAATAAATAAAATCAAATGGTCATATATGAAGGAGAATGGGTAAATGATCTTTTTGATG
GATAAGGTATTTTATATAATTAATTTCCTGAAAATTTATAGAATTCTTTCAGCTATAGTG
ATTTTAATAAAATATCTAATTATTGGAAAGTTTATGAAGGAGAATTCTAATTAGGATTAA
AAAATGGTTCAGGTACCCTAGTTTTTACAAACGAAGAAAAGTATAGCGGCAAGTTTATAA
ATGATAAAGTTAATGGAGAAGGTGTTTTTTATTCAAATGATAGCAAAAAGCAACCAATAG
TAGGATTATGGGTAAATAATATCTTATCAAAAATATTATGA