Identifiers and Description

Gene Model Identifier

TTHERM_00600230

Standard Name

MRNC07 (Membrane Occupation and Recognition Nexus protein C-terminal)

Aliases

PreTt22086 | 83.m00155 | 3685.m00047

Description

protein with predicted MORN domains localized at the C-terminus of the protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.5%

TetraMine Data

TTHERM_00600230

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_14890.12.0002546692351096e-156hypothetical protein (381 aa)
OxytrichaContig9596.0.g470.0000000000000030004923591262316MORN repeat
DictyBaseDDB_G03494880.00000030014504373857585DDB_G0349488 on chromosome: 2
position 6912714 to 6914186

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00600230(coding)
ATGAAGAAACTTTTCAACATGTTTTCATCTAGGCCTCACTATAATATAGAGGACGTCAAG
ACTCCATCTAACCAAAATTATAAGGTCTTTGATGCTGATTGCTCTGCTGTTCCTATTTTT
GAAAACTAAATGAAAGATATATCCTACATAAATGCAGATAGAGGTAGCACATTAGAAATA
AATAGAGTTAATGAAGAAGATACTAGCTCATATCAAGCTGCTCCTATTCAAGTTATTTCT
CCTTAAGCACCACAAAAAATTATAAATCAAAAAATTAAAACTGTGCGTATACGCTTAATC
TAAGAGAAGCAAAGCAAATCCTCTATTTCAAACAGTCAAGAAAAATACAAAGCTGAAGTA
AAAGCAAAGGATTAATGCTTTAAATAAATTGCAAAGACAATATATATTTTCTACACTGCA
GAGGACTTGCTTGCTTAATTAGCTACCTGCTCTTACTTCAATGGATTTAAACCTTTGAAC
TACAATCACATCAAATAATGCCTATTTCCTTCTAATGATTGCAATGACCAAAACGCCTAA
AAATAAAAAAAGAAAAGCTCTATTTAAGTACTCAAGTATTATATAACTTAAACAGATGAA
GGAGAATATCATGGCTAAATGAATAAAAATAAAGTACCTGAAGGCAACTCAATACTATTC
TACAAAAATGGTAATTAATACATTGGTGAAATGAAAAATAGATTTAGAAACGGATAAGGT
TCTATGTTCTATCCAGACGGTAGCTCATATACCGGCGGATGGGTTCTAGATGCTAAAGAA
GGATAAGGTAAAGAAACAGAAACAAAAGGAGAAGTATTTACTGGAAACTTCATAAACAAT
TGTAGAAGCGGAAAAGGATAATTAATTTATAAAAACGGCTATGTTCTTGAATCAAACTGG
ATTAATGGCTATTAAGATGGTCTCTCCACATTAAGTGTTGGTAAATAATAAATTCAAGTC
CTATTCTGCATGGGCTAAATAGTGAAAATAAACTCAACTCCTATATAGGATTTGTAAAAC
GTTTCTAATGAAAATCAAAATATAACGAATTTAATTTAAATAAATTTCTGCAGAGACTAA
GTATAAGTCTTTAAAAACCAACCTATTCCTTCTTACCTCACTGCAAGATTTTGA


>TTHERM_00600230(protein)
MKKLFNMFSSRPHYNIEDVKTPSNQNYKVFDADCSAVPIFENQMKDISYINADRGSTLEI
NRVNEEDTSSYQAAPIQVISPQAPQKIINQKIKTVRIRLIQEKQSKSSISNSQEKYKAEV
KAKDQCFKQIAKTIYIFYTAEDLLAQLATCSYFNGFKPLNYNHIKQCLFPSNDCNDQNAQ
KQKKKSSIQVLKYYITQTDEGEYHGQMNKNKVPEGNSILFYKNGNQYIGEMKNRFRNGQG
SMFYPDGSSYTGGWVLDAKEGQGKETETKGEVFTGNFINNCRSGKGQLIYKNGYVLESNW
INGYQDGLSTLSVGKQQIQVLFCMGQIVKINSTPIQDLQNVSNENQNITNLIQINFCRDQ
VQVFKNQPIPSYLTARF


>TTHERM_00600230(gene)
ATGAAGAAACTTTTCAACATGTTTTCATCTAGGCCTCACTATAATATAGAGGACGTCAAG
ACTCCATCTAACCAAAATTATAAGGTCTTTGATGCTGATTGCTCTGCTGTTCCTATTTTT
GAAAACTAAATGAAAGATATATCCTACATAAATGCAGATAGAGGTAGCACATTAGAAATA
AATAGAGTTAATGAAGAAGATACTAGCTCATATCAAGCTGCTCCTATTCAAGTTATTTCT
CCTTAAGCACCACAAAAAATTATAAATCAAAAAATTAAAACTGTGCGTATACGCTTAATC
TAAGAGAAGCAAAGCAAATCCTCTATTTCAAACAGTCAAGAAAAATACAAAGCTGAAGTA
AAAGCAAAGGATTAATGCTTTAAATAAATTGCAAAGACAATATATATTTTCTACACTGCA
GAGGACTTGCTTGCTTAATTAGCTACCTGCTCTTACTTCAATGGATTTAAACCTTTGAAC
TACAATCACATCAAATAATGCCTATTTCCTTCTAATGATTGCAATGACCAAAACGCCTAA
AAATAAAAAAAGAAAAGCTCTATTTAAGTACTCAAGTATTATATAACTTAAACAGATGAA
GGAGAATATCATGGCTAAATGAATAAAAATAAAGTACCTGAAGGCAACTCAATACTATTC
TACAAAAATGGTAATTAATACATTGGTGAAATGAAAAATAGATTTAGAAACGGATAAGGT
TCTATGTTCTATCCAGACGGTAGCTCATATACCGGCGGATGGGTTCTAGATGCTAAAGAA
GGATAAGGTAAAGAAACAGAAACAAAAGGAGAAGTATTTACTGGAAACTTCATAAACAAT
TGTAGAAGCGGAAAAGGATAATTAATTTATAAAAACGGCTATGTTCTTGAATCAAACTGG
ATTAATGGCTATTAAGATGGTCTCTCCACATTAAGTGTTGGTAAATAATAAATTCAAGTC
CTATTCTGCATGGGCTAAATAGTGAAAATAAACTCAACTCCTATATAGGATTTGTAAAAC
GTTTCTAATGAAAATCAAAATATAACGAATTTAATTTAAATAAATTTCTGCAGAGACTAA
GTATAAGTCTTTAAAAACCAACCTATTCCTTCTTACCTCACTGCAAGATTTTGA