Identifiers and Description

Gene Model Identifier

TTHERM_00670360

Standard Name

MRNC06 (Membrane Occupation and Recognition Nexus protein C-terminal)

Aliases

PreTt01060 | 100.m00121 | 3731.m00031

Description

protein with predicted MORN domains localized at the C-terminus of the protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 11.8%

TetraMine Data

TTHERM_00670360

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_16450.19.997093137033517e-262hypothetical protein (362 aa)
OxytrichaContig3507.0.0.g292.0004286606204839e-16MORN repeat
DictyBaseDDB_G02906790.000004000864880866421DDB_G0290679 on chromosome: 5
position 4358106 to 4360111
WormBaseWBGene000021790.00003998524687536623locus:jph-1 status:Confirmed
UniProt:Q22667 protein_id
:CAA99924.2

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00670360(coding)
ATGGAAAGCGATAACTGTGCTTATCACCCAGCAAAATAAATAGAATTAATATGTTTAGAA
GAGAGTTGCCCTGAAAAAGGATGTATGTTTTGTGCATTTTGTTTCTTAGTTGATGGAGTT
CATCACAATCATAAATTTGTAGAAAGTGAAAAAATTCAATAATTTGTAGAAGAAAATGGG
GAAAGATTTTTACAGAAAGTAATTCAAAAAGCTGACTAAATGTGTTATGAGCTGACTACA
GAAATATGGAACTTTAAAAATTTTTTTGTGGACTATGCTAAAAAGTGTATTTAAGAGCTA
ACAGACCTTTTATAAAGCTCTGACTAAGAGCATCTAATAAATAATATCAGCCTAATATAA
GATATTTAAACAATTGTAGAAGAAAATGAAAACCATCGCATATTTTAAATGATAAAATCA
TCTTAATAGCGAATAACGTTGCACTTAAAAAATTGCATAATACCTTTAGATTATAGTTAT
GAGAAGGTTTATTAATTTGAAAAAAATAAGATAAAAGACTTGATAGATAAATATACTTAA
TTTTAATTGACTGATTCTGTAAAGACTACATTATAGTAAATAGAACCTTTTTTATATGAC
CAGCCTCATTTGGAGAACTTTAAGTATCCTTAATTAGTTGAAGAGTAATATAAAAAAACT
AAGGACATATCTTTCAAGTAATATGATTTAGAAACAAAACGCTCTAATGGAAGAGGTATG
ATTATTAGAGAAGATGGGAGTTATTTTGAGGGATATTTTTTAGATGGTAAAATAGAGGGA
AAAGGTAGAAATATATGGCCAGAAGGAGATTGGTATGAAGGTGGATTTAAAAAAGGTAAA
AAACATGGATTTGGGACACAGAGGTTGAGTGATAAACTTTATTTTGGAGAATATGTAGAA
GATTATAGAGAGGGTTATGGGACAATTATATTTGATAATGGAGATACTTATAGAGGATGT
ATGTATTAAGATAATATGTGTGGCTATGGAGAACTTATTACTGCAAATGGAAAGATGGTT
AGAGGGTATTTTGTTGACAACGAATTTAAAGGATAGACTTATAATGATGTAATTAAATAA
GATTTTTAAAATCTAAAAATCTAATGA


>TTHERM_00670360(protein)
MESDNCAYHPAKQIELICLEESCPEKGCMFCAFCFLVDGVHHNHKFVESEKIQQFVEENG
ERFLQKVIQKADQMCYELTTEIWNFKNFFVDYAKKCIQELTDLLQSSDQEHLINNISLIQ
DIQTIVEENENHRIFQMIKSSQQRITLHLKNCIIPLDYSYEKVYQFEKNKIKDLIDKYTQ
FQLTDSVKTTLQQIEPFLYDQPHLENFKYPQLVEEQYKKTKDISFKQYDLETKRSNGRGM
IIREDGSYFEGYFLDGKIEGKGRNIWPEGDWYEGGFKKGKKHGFGTQRLSDKLYFGEYVE
DYREGYGTIIFDNGDTYRGCMYQDNMCGYGELITANGKMVRGYFVDNEFKGQTYNDVIKQ
DFQNLKIQ


>TTHERM_00670360(gene)
ATGGAAAGCGATAACTGTGCTTATCACCCAGCAAAATAAATAGAATTAATATGTTTAGAA
GAGAGTTGCCCTGAAAAAGGATGTATGTTTTGTGCATTTTGTTTCTTAGTTGATGGAGTT
CATCACAATCATAAATTTGTAGAAAGTGAAAAAATTCAATAATTTGTAGAAGAAAATGGG
GAAAGATTTTTACAGAAAGTAATTCAAAAAGCTGACTAAATGTGTTATGAGCTGACTACA
GAAATATGGAACTTTAAAAATTTTTTTGTGGACTATGCTAAAAAGTGTATTTAAGAGCTA
ACAGACCTTTTATAAAGCTCTGACTAAGAGCATCTAATAAATAATATCAGCCTAATATAA
GATATTTAAACAATTGTAGAAGAAAATGAAAACCATCGCATATTTTAAATGATAAAATCA
TCTTAATAGCGAATAACGTTGCACTTAAAAAATTGCATAATACCTTTAGATTATAGTTAT
GAGAAGGTTTATTAATTTGAAAAAAATAAGATAAAAGACTTGATAGATAAATATACTTAA
TTTTAATTGACTGATTCTGTAAAGACTACATTATAGTAAATAGGTAAATAATAAATTATT
TAATATAAAATGAAAATTAAATATAAAGATTGATATATATAAATGTATTTAGAACCTTTT
TTATATGACCAGCCTCATTTGGAGAACTTTAAGTATCCTTAATTAGTTGAAGAGTAATAT
AAAAAAACTAAGGACATATCTTTCAAGTAATATGATTTAGAAACAAAACGCTCTAATGGA
AGAGGTATGATTATTAGAGAAGATGGGAGTTATTTTGAGGGGTATATTTTTATTTTCTTT
GGAGTGTTAAAAAATTTATCATTTTTGTTGTAAATAAATAGATATTTTTTAGATGGTAAA
ATAGAGGGAAAAGGTAGAAATATATGGCCAGAAGGAGATTGGTATGAAGGTGGATTTAAA
AAAGGTAAAAAACATGGATTTGGGACACAGAGGTTGAGTGATAAACTTTATTTTGGAGAA
TATGTAGAAGATTATAGAGAGGGTTATGGGACAATTATATTTGATAATGGAGATACTTAT
AGAGGATGTATGTATTAAGATAATATGTGTGGCTATGGAGAACTTATTACTGCAAATGGA
AAGATGGTTAGAGGGTATTTTGTTGACAACGAATTTAAAGGATAGACTTATAATGATGTA
ATTAAATAAGATTTTTAAAATCTAAAAATCTAATGA