Identifiers and Description

Gene Model Identifier

TTHERM_00499480

Standard Name

MRNC03 (Membrane Occupation and Recognition Nexus protein C-terminal)

Aliases

PreTt07991 | 63.m00169 | 3716.m00023

Description

protein with predicted MORN domains localized at the C-terminus of the protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 9.9%

TetraMine Data

TTHERM_00499480

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_09685.16.0028450615922e-38hypothetical protein (735 aa)
OxytrichaContig5936.0.g290.0000000006000548789370351MORN repeat

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00499480(coding)
ATGAGAAATTTAAGAGGTAAAATACAAACCTTTTATTCTAAAGAAGGGTTGAAATCTAAA
GAGTATAAAACAGGTATTTACTAAGGTGAGTATAAAAACTAAAAAGGTAATTTAAGAGAA
GGAAAAGGAGTGTTCTATTGGTATGGAGGTTAGATATACATAGGGCAATGGCAAAATGAT
TAGATTGAAGGATATGGAAGAGTTTATTTTCCTTATGGAGGATAGTTTATAGGATTCTTT
AAATAAAATAAAGCTTGTGGAATTGGTATTATGACCCTTAGAAATTAAAAAATATATGCT
GGGAACTGA


>TTHERM_00499480(protein)
MRNLRGKIQTFYSKEGLKSKEYKTGIYQGEYKNQKGNLREGKGVFYWYGGQIYIGQWQND
QIEGYGRVYFPYGGQFIGFFKQNKACGIGIMTLRNQKIYAGN


>TTHERM_00499480(gene)
ATGAGAAATTTAAGAGGTAAAATACAAACCTTTTATTCTAAAGAAGGGTTGAAATCTAAA
GAGTATAAAACAGGTATTTACTAAGGTGAGTATAAAAACTAAAAAGGTAATTTAAGAGAA
GGAAAAGGAGTGTTCTATTGGTATGGAGGTTAGATATACATAGGGCAATGGCAAAATGAT
TAGATTGAAGGATATGGAAGAGTTTATTTTCCTTATGGAGGATAGTTTATAGGATTCTTT
AAATAAAATAAAGCTTGTGGAATTGGTATTATGACCCTTAGAAATTAAAAAATATATGCT
GGGAACTGA