Identifiers and Description

Gene Model Identifier

TTHERM_00085220

Standard Name

MRK1 (MAP-related kinase )

Aliases

PreTt16370 | 6.m00444 | MRK | 3836.m02037

Description

MAP-related kinase; recombinant MRK autophosphorylates, and phosphorylates myelin basic protein (MBP); transcription increases with temperature downshift from 35 to 15 degrees C, or with osmotic shock

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.8%

TetraMine Data

TTHERM_00085220

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_02429.17.996875492733741e-171protein kinase domain-containi
ng protein (625 aa)
OxytrichaContig10155.0.g642.0007864815129413e-165Protein kinase domain
DictyBaseDDB_G02863532.9998512931988133e-83erkA on chromosome: 4 position
4355028 to 4356796
Stentor CoeruleusSteCoe_123658.854771883513433e-70
WormBaseWBGene000034014.001968334034435e-68locus:mpk-1 Mitogen-activate
d protein kinase mpk-1 statu
s:Confirmed UniProt:P39745
protein_id:CAA87057.1
SGDYHR030C5.999140071902665e-66SLT2 Serine/threonine MAP kina
se; involved in regulating mai
ntenance of cell wall integrit
y, progression through the cel
l cycle, and nuclear mRNA rete
ntion in heat shock; required
for mitophagy and pexophagy; a
ffects recruitment of mitochon
dria to the phagophore assembl
y site (PAS); regulated by the
PKC1-mediated signaling pathw
ay

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:16933976: Eisen JA, Coyne RS, Wu M, Wu D, Thiagarajan M, Wortman JR, Badger JH, Ren Q, Amedeo P, Jones KM, Tallon LJ, Delcher AL, Salzberg SL, Silva JC, Haas BJ, Majoros WH, Farzad M, Carlton JM, Smith RK, Garg J, Pearlman RE, Karrer KM, Sun L, Manning G, Elde NC, Turkewitz AP, Asai DJ, Wilkes DE, Wang Y, Cai H, Collins K, Stewart BA, Lee SR, Wilamowska K, Weinberg Z, Ruzzo WL, Wloga D, Gaertig J, Frankel J, Tsao CC, Gorovsky MA, Keeling PJ, Waller RF, Patron NJ, Cherry JM, Stover NA,
  2. Ref:10187773: Nakashima S, Wang S, Hisamoto N, Sakai H, Andoh M, Matsumoto K, Nozawa Y (1999) Molecular cloning and expression of a stress-responsive mitogen-activated protein kinase-related kinase from Tetrahymena cells. The Journal of biological chemistry 274(15):9976-83
  3. Ref:10735176: Nakashima S, Nozawa Y (1999) Stress-responsive gene expression in Tetrahymena. Acta biologica Hungarica 50(4):413-24

Sequences

>TTHERM_00085220(coding)
ATGGACAAAAAGTTATCTTCCAAGAATTTTTCCGACTGGGAGGTTGGTGATAGATATGAT
CTTATTAAGGTTGTAGGTAGTGGTTCTTATGGTTCTGTAGCTGAAGCTACTGACAAGAAA
TCAGGCAAGAAAGTTGCCATTAAGAGATTGAATGGTATCTTCGAAGACAATGTTGACTGC
AAACGTATTCTTAGAGAAATTCACTTGTTACGTATTTTAAATCACCCTAACCTTATTAGA
ATCAATGAAATTATTGAACCTAAGGACTTATAGAACTTCGACACTCTTTATGTCGTTACT
GAATATTGCTAATCCGACCTTAAAAAGCTCTTCAAGTCACCTATTCACTTGTGCATGATC
CAAGTTTAAACATTAACCTACAACATTCTCACTGGTATTAAATATCTCCACTCTGCTGAA
GTACTTCATAGAGATCTCAAGCCTGCTAACGTCCTTATCAATGAAGATTGCTCTGTCAAG
ATTTGTGACTTTGGTCTCGCCAGATCTGTAGAAGGTATTGAAGGTGCACATATTTATGAT
GATAGAAATAGCAACAGCCCTCAAAAGTAATAAACCAGTAGCCAAAGCCCTGAAAAGCCT
GCAGCTACCAGCAGTGGAAGACCTAAACTTTCTAAAGAAAAGGGAATTAACTCTAAAACC
ACTAAGAGAGAATTGACTGGCCACGTAGTTACTCGTTGGTACAGAGCTCCCGAATTGATT
CTTTTGGAAAAAGATTACACTGCTGCCATTGATATCTGGAGTATTGGTTGTATCTTCGCT
GAATTGATGAATATGATCAAGGAAAACTCCCCCACCTTCTTAGATAGATCTCCTCTTTTC
CCTGGTAGCAGCTGCTTCCCCCTCTCACCTGATAGAAACAACACAGTTAAGTAGGGTGGA
TTCCCCCACAGCCACAGTGATTAATTGAATGTCATCTTCTCAGTCTTGGGTACCCCTAAT
GAAGAAGATATGGACTTCGTCACTGATGCTAAGGCTATCGAATATTTAAAGAGCTTCAAG
CAAAAGAAGAGAGTCGACTTCAAGGATTTATTCCCAGCTGCCACCCCTGAATGTATTGAT
TTCTTGAACAAAACCCTTGTCTTCAACCCTCGTAAAAGAATTACTATTGATGCTGCCCTC
AACCATCCTCTCTTTACCCCTGTCAGAGATATCAAGAAAGAAGTATTTGCTGATGGCTCC
GTTGTTCTTCCCTTTGAAAAAGAAGGAGACATGGCTATACCTAGACTCCGTGAACTCTTC
ATCGAAGAAATCAAGCGTTATCACACTAAGTGA


>TTHERM_00085220(protein)
MDKKLSSKNFSDWEVGDRYDLIKVVGSGSYGSVAEATDKKSGKKVAIKRLNGIFEDNVDC
KRILREIHLLRILNHPNLIRINEIIEPKDLQNFDTLYVVTEYCQSDLKKLFKSPIHLCMI
QVQTLTYNILTGIKYLHSAEVLHRDLKPANVLINEDCSVKICDFGLARSVEGIEGAHIYD
DRNSNSPQKQQTSSQSPEKPAATSSGRPKLSKEKGINSKTTKRELTGHVVTRWYRAPELI
LLEKDYTAAIDIWSIGCIFAELMNMIKENSPTFLDRSPLFPGSSCFPLSPDRNNTVKQGG
FPHSHSDQLNVIFSVLGTPNEEDMDFVTDAKAIEYLKSFKQKKRVDFKDLFPAATPECID
FLNKTLVFNPRKRITIDAALNHPLFTPVRDIKKEVFADGSVVLPFEKEGDMAIPRLRELF
IEEIKRYHTK


>TTHERM_00085220(gene)
ATGGACAAAAAGTTATCTTCCAAGAATTTTTCCGACTGGGAGGTTGGTGATAGATATGAT
CTTATTAAGGTTGTAGGTAGTGGTTCTTATGGTTCTGTAGCTGAAGCTACTGACAAGAAA
TCAGGCAAGAAAGTTGCCATTAAGAGATTGAATGGTATCTTCGAAGACAATGTTGACTGC
AAACGTATTCTTAGAGAAATTCACTTGTTACGTATTTTAAATCACCCTAACCTTATTAGA
ATCAATGAAATTATTGAACCTAAGGACTTATAGAACTTCGACACTCTTTATGTCGTTACT
GAATATTGCTAATCCGACCTTAAAAAGCTCTTCAAGTCACCTATTCACTTGTGCATGATC
CAAGTTTAAACATTAACCTACAACATTCTCACTGGTATTAAATATCTCCACTCTGCTGAA
GTACTTCATAGAGATCTCAAGCCTGCTAACGTCCTTATCAATGAAGATTGCTCTGTCAAG
ATTTGTGACTTTGGTCTCGCCAGATCTGTAGAAGGTAATTAAAATCTCAGATTTTCATTT
TTCACTTTCTCACTTTTGATTGGCTTTATCATTTATTTAACACTTTTAAGGATGAAAATG
ATCCTCCTTCTTCTATTTCTCAAATACCATAAAGTCAAATAGTAATAATAAATGTTAAAT
AACAATATCATGTTAAATTGCTATACAACTTCTACTTTTTGATTCATTTAAAACTCATTT
TTATACATTTTTCTATCAAATATAATCTAATTGGTTTTAAAAAAACCGAATTTCTAAAAC
TAATCTAAAGAAATTCTTAAACAGAATTAATATCCACAGGCAATGACTTCAAGAAGTCGT
TGTTTAAACAAACACTACTCCAAAATATTATTAAAATTAAAAAAAAATCTCCACATTGAA
GATGATCTGCAAGAGTTTATCCTAAAAACTCGAGTAATAAATAAATAAAAGAAATATAAA
TAGATCAAATTGTTAAATGAATAATCGAGTTTGTTTCTAAAAAAATAAAATAAACAATAA
AAGTCTACTTAACATAGCTCATTTCATGATGAATTTAGCTAATAAATAGATGATAACCTA
GCAATCTTAGTAAATTAGGAAAATATAATTCAAGATTAATAATAGATAGTCAAGGCGATA
GAAACAAAGAAAGAAAGAAAAAATAAAAATAGATATTTCAGCAAACAAAATAGCAAAATA
AAATTCTATGAAAAAAAAACATAAAGAAATTTAAATAATTATCAGCAAGCATCAAATTAA
TTATTGTAAAAAGCAGATAGATAGATAGATTAAAAATTCTTATGTTAATCTAAGAATAAA
TTTTAGCCAACAATAATTTTTTTAATTAAAAAATTGTCTTTTTTATTTTTATTAAATAAA
TAATTAATTAAATTAATAAAATAAAGGTATTGAAGGTGCACATATTTATGATGATAGAAA
TAGCAACAGCCCTCAAAAGTAATAAACCAGTAGCCAAAGCCCTGAAAAGCCTGCAGCTAC
CAGCAGTGGAAGACCTAAACTTTCTAAAGAAAAGGGAATTAACTCTAAAACCACTAAGAG
AGAATTGACTGGCCACGTAGTTACTCGTTGGTACAGAGCTCCCGAATTGATTCTTTTGGA
AAAAGATTACACTGCTGCCATTGATATCTGGAGTATTGGTTGTATCTTCGCTGAATTGAT
GAATATGATCAAGGAAAACTCCCCCACCTTCTTAGATAGATCTCCTCTTTTCCCTGGTAG
CAGCTGCTTCCCCCTCTCACCTGATAGAAACAACACAGTTAAGTAGGGTGGATTCCCCCA
CAGCCACAGTGATTAATTGAATGTCATCTTCTCAGTCTTGGGTACCCCTAATGAAGAAGA
TATGGACTTCGTCACTGATGCTAAGGCTATCGAATATTTAAAGAGCTTCAAGCAAAAGAA
GAGAGTCGACTTCAAGGATTTATTCCCAGCTGCCACCCCTGAATGTATTGATTTCTTGAA
CAAAACCCTTGTCTTCAACCCTCGTAAAAGAATTACTATTGATGCTGCCCTCAACCATCC
TCTCTTTACCCCTGTCAGAGATATCAAGAAAGAAGTATTTGCTGATGGCTCCGTTGTTCT
TCCCTTTGAAAAAGAAGGAGACATGGCTATACCTAGACTCCGTGAACTCTTCATCGAAGA
AATCAAGCGTTATCACACTAAGTGA