Identifiers and Description

Gene Model Identifier

TTHERM_00721450

Standard Name

MRE11 (Homolog of budding yeast MRE11 and of fission yeast RAD32)

Aliases

PreTt18453 | 115.m00109

Description

Ser/Thr protein phosphatase family protein. Mre11p is required for the repair of meiotic double-strand breaks and full chromosome pairing.

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Biological Process

Domains

  • ( PF04152 ) Mre11 DNA-binding domain
  • ( PF04702 ) Vicilin N terminal region
  • ( TIGR00583 ) DNA repair protein (mre11)
  • ( TIGR00619 ) exonuclease SbcCD, D subunit
  • ( PF04837 ) MbeB-like, N-term conserved region
  • ( TIGR00040 ) phosphodiesterase, MJ0936 family
  • ( PF00149 ) Ser/Thr protein phosphatase family protein
  • ( PF04259 ) Small, acid-soluble spore protein, gamma-type

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00721450

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_17472.19.997093137033517e-262Ser/Thr protein phosphatase (8
96 aa)
OxytrichaContig6051.0.g682.0004907641180118e-81Calcineurin-like phosphoestera
se
DictyBaseDDB_G02935461.9999590304423412e-72mre11 on chromosome: 6 positio
n 3016431 to 3018565
WormBaseWBGene000034051.9999167998962255e-60locus:mre-11 Double-strand b
reak repair protein mre-11 s
tatus:Partially_confirmed Un
iProt:Q23255 protein_id:CAA9
8292.2
SGDYMR224C3.0014802379878627e-60MRE11 Subunit of a complex wit
h Rad50p and Xrs2p (MRX comple
x) that functions in repair of
DNA double-strand breaks and
in telomere stability, exhibit
s nuclease activity that appea
rs to be required for MRX func
tion; widely conserved
Stentor CoeruleusSteCoe_227842.6786369618080778e-33

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:26519827: Lukaszewicz A, Shodhan A, Loidl J (2015) Exo1 and Mre11 execute meiotic DSB end resection in the protist Tetrahymena. DNA repair 35( ):137-43
  2. Ref:20422424: Lukaszewicz A, Howard-Till RA, Novatchkova M, Mochizuki K, Loidl J (2010) MRE11 and COM1/SAE2 are required for double-strand break repair and efficient chromosome pairing during meiosis of the protist Tetrahymena. Chromosoma 119(5):505-18

Sequences

>TTHERM_00721450(coding)
ATGAAAAAAAATAACTTTGTTTTAACTTAGGTCGAAAAGAAAAATGTCTTTAAAGATTAG
GAAAATACTTTTAAGATATTAGTTGCCACTGATAACCATGTAGGATATAAAGAAAACGAC
CCTATTAGAGGGAACGACTCTTTTGAAGCTTTTGAAGAAGTATTAAAAATAGCAAAAAGC
GAAAAAGTAGACTTTTTACTTTTAGGAGGAGATCTTTTTCATGAGACCAATCCTTCTTAG
CAGTGTTTATATAAAATGCTAAATTTATTGGGTAATTATGTTTTAGGTGATGGCGAAATT
TTGTATGGGATATCGAATTATAATGATGTAAATTTTCAAGATTGCAATTTGAATATAGAA
TTGCCAATCTTTGTCATCCATGGTAATCATGACTACCCTTCAGATGAGTATGGAAATTTA
AGCGTAATAGACCTTCTTCACGCAACAAAATACCTCAATCACTTTGGAAAATTCTCCAAC
ATTGAATAAATAAAGGTTACTCCTATAATCTTCCAGAAAGGCAATACAACAGTAGCTTTG
TATGGAATTGGATACTTAAAAGATAAATACTTTCATAAAATGCTTGAGGAGGGTAAAATA
GAGTTTGTTAAACCTGAATAAATGGGGTATAAGGACACAGTGAATATTTTAGTCATTCAT
TAAAATAGATACAAAGGAATCAGATAAGGACAATCTTACAGAAATTGTGTGCATCCTGAA
TAATTTCCAGAGTGGATTGACTTTATAATTAGAGGTCACGAGCATGAATAAAAAGATGAT
ATAGATATTATGAAAGAATGTCCTATTGCTACTATTTAACCTGGCTCTACTATATTAACA
GCAATAGAAGATGTTTAGGCAACACCAAGAAGAGCTATATTATTTGAAATAAAAGGCCTT
GAAGCTAACTTTTAAGATATTACTCTAATTTAATCATATAGGCCAGTTTTATATGAGCAT
GTTGAATTAACTAGTGTAGTAAAAAAAGCAGGATTCGATTTAGATAATGAAGTACCTGCA
GATTAGGCTGTAGAAGAAGTTCTATGGCAATTTATTTAACAGTCTATCAACAATTTTAAA
ATAGTCTTGAAAGAAAATTTTCCAAACAGTCCTCATTTATTTGCTAAAAAACCTATTTTA
AGATTTAAAATTGAGCAAAGCAATTTTGATGTTTTTAACTTTCAAAGAATAGAATCTAAA
CTGTCAGACTTGGTTGCAAATCCAGGTGAAGTGCTTAAATTTTGGAAAAGAATAATAATT
AATCCTAAAACTATTAAAAATCCAAAATTAGAAGAAGATTTTATCAAAACTTTAAAAGGA
AAATCAGATTTTGATACAATAGGTAATGAAACTGTCAAGGATATTAAAGAATTATATGAA
GATAGGATTAAAAAAAATAAATCTATTTCATGCCTGCCGAGCAGTCTTATAATGGATACC
CTTGAAAAAGTTAATTTGAGGAATAGAAACTCTTCTATAGAAGACATAATCAAGAATTTA
CAAAATAAATTACAGGAAAATGTAGCTGTTTAGGAGGAGAAAGAAATAAGGAAGGTTAAT
GAACAATATCGTTAATAAATGAACAGCGTTTTATAAAAAATATCTACTAATATTGATGAG
AGATAAAAAGATAAAATAGATCTTGACTTAAAAAACAGTGATAAAATTATATACAAAACT
TTGATGAACAATTAATTTGATGATCTGAAACAAAGTTTAAATGAGAAAATAAGGACAAAA
GTGGCTGAGCTATTCATTCAAGACTTTTAATAGGATGGAGATAATGATATTGATATAGAA
AATAATAGTGATGGCTAATATAAGGAAAGTAGTACAAATAAAAAAAGTTTGAATTCTGAT
TAAATGGATAGTGAAGAAGAAGATAATAAAACTAGTAAAGTTAAAGGACGAGGAAGAAAA
AGAACTGAAAATAAATCTATCACAACGAAAAAGTAAGTCAAGGACTTTGAATTAGAAGAT
AATGATTATGAAAATGAAAATATACATGATGAGGAAGATGAAAATTAAATTTCATAATAG
AAAGGATTTAAAGGCAAATTTAAGAATAGCAAATTAGCCAAAGAAAAGGCAAACTAAAAC
TTGAAAAATAGATAAGAAATAAAAGTTGAAGATTCAAGTGATCAAGATGAAGAAAAAATT
GAAAAAGTAAATAGAAGAATAAAAAAAAGTGATAATAAAAGAGATTTCAATGCTGAAAAT
GAAAAACCTAATATGAAAAGTGGGTTTAAATAAAAAATGACATACGCTCAGTTATTCAAG
AAATAAAATAGAATGGATTAAGAAGAAGAAGAAGACTATGAAGAAAATTAATAAAGTGAT
GAAGATGCTTCACAGCAATCAGATTGTGAATTTGGGTTAAATGGAGAGAAATAAAAAATT
AGTTATAATATTGCTCATATTTCTGAAATACAAAAAAAGAACTAAAGCAATAAGTCTCTT
CCATTATTGCAAGTTCAATAAAAGAAAGAATAAAGTAGTGCTATTAAGATAGAGAATTCT
AGCAATACTAGGCAGAGTATTTTAAGCAAAAAAAAGCCCCAAGCACCACAAGATGAGCCA
AGAAGAGAGTAAAAAGAGCTGGATATAAGAGAATTGATGATGAAAAGAATGAATTAAGCA
AATGTTAAAAATTGA


>TTHERM_00721450(protein)
MKKNNFVLTQVEKKNVFKDQENTFKILVATDNHVGYKENDPIRGNDSFEAFEEVLKIAKS
EKVDFLLLGGDLFHETNPSQQCLYKMLNLLGNYVLGDGEILYGISNYNDVNFQDCNLNIE
LPIFVIHGNHDYPSDEYGNLSVIDLLHATKYLNHFGKFSNIEQIKVTPIIFQKGNTTVAL
YGIGYLKDKYFHKMLEEGKIEFVKPEQMGYKDTVNILVIHQNRYKGIRQGQSYRNCVHPE
QFPEWIDFIIRGHEHEQKDDIDIMKECPIATIQPGSTILTAIEDVQATPRRAILFEIKGL
EANFQDITLIQSYRPVLYEHVELTSVVKKAGFDLDNEVPADQAVEEVLWQFIQQSINNFK
IVLKENFPNSPHLFAKKPILRFKIEQSNFDVFNFQRIESKLSDLVANPGEVLKFWKRIII
NPKTIKNPKLEEDFIKTLKGKSDFDTIGNETVKDIKELYEDRIKKNKSISCLPSSLIMDT
LEKVNLRNRNSSIEDIIKNLQNKLQENVAVQEEKEIRKVNEQYRQQMNSVLQKISTNIDE
RQKDKIDLDLKNSDKIIYKTLMNNQFDDLKQSLNEKIRTKVAELFIQDFQQDGDNDIDIE
NNSDGQYKESSTNKKSLNSDQMDSEEEDNKTSKVKGRGRKRTENKSITTKKQVKDFELED
NDYENENIHDEEDENQISQQKGFKGKFKNSKLAKEKANQNLKNRQEIKVEDSSDQDEEKI
EKVNRRIKKSDNKRDFNAENEKPNMKSGFKQKMTYAQLFKKQNRMDQEEEEDYEENQQSD
EDASQQSDCEFGLNGEKQKISYNIAHISEIQKKNQSNKSLPLLQVQQKKEQSSAIKIENS
SNTRQSILSKKKPQAPQDEPRREQKELDIRELMMKRMNQANVKN


>TTHERM_00721450(gene)
ATGAAAAAAAATAACTTTGTTTTAACTTAGGTCGAAAAGAAAAATGTCTTTAAAGATTAG
GAAAATACTTTTAAGATATTAGTTGCCACTGATAACCATGTAGGATATAAAGAAAACGAC
CCTATTAGAGGGAACGACTCTTTTGAAGCTTTTGAAGAAGTATTAAAAATAGCAAAAAGC
GAAAAAGTAGACTTTTTACTTTTAGGAGGAGATCTTTTTCATGAGACCAATCCTTCTTAG
CAGTGTTTATATAAAATGCTAAATTTATTGGGTAATTATGTTTTAGGTGATGGCGAAATT
TTGTATGGGATATCGAATTATAATGATGTAAATTTTCAAGATTGCAATTTGAATATAGAA
TTGCCAATCTTTGTCATCCATGGTAATCATGACTACCCTTCAGATGAGTATGGAAATTTA
AGCGTAATAGACCTTCTTCACGCAACAAAATACCTCAATCACTTTGGAAAATTCTCCAAC
ATTGAATAAATAAAGGTATAAAATATTTTAATGATTTAATCAATATAAAATAAATTTATT
TAATAAGAGATAAAGCTATTTATTGCCAATTAAAGTTAATCATTGTGAGAAATTAAGAAG
AAAAAAAATATTCTTAAAATATTTTATTAAAACTAATTTAAAGATAATAAAATAAATAAA
TTTTAGAAAATTAACACAAATTTAATTTATTTTATTCAAATTAATTTACCTCAAAATAGT
TACTTTATAAAATATTAAGAAGAGTTTTATATAAAATTAACAAATACTTACCAATCAGCT
TAGTTCCAAATTAATTATTTTATTTAAATTAATTATTTTTCAATTAAAATATTGAAATTT
TAATTATTTAATAATGATGTCCTGAAGATTGAATCATATAATATACAGAACTTATATAAT
AAAAAGAAGAAAAACTAATATTAATTAGAAGGTCTCTATCTAAATATTTACTTTTGAAAT
AAAAAATAGGTTACTCCTATAATCTTCCAGAAAGGCAATACAACAGTAGCTTTGTATGGA
ATTGGATACTTAAAAGATAAATACTTTCATAAAATGCTTGAGGAGGGTAAAATAGAGTTT
GTTAAACCTGAATAAATGGGGTATAAGGACACAGTGAATATTTTAGTCATTCATTAAAAT
AGATACAAAGGAATCAGATAAGGACAATCTTACAGAAATTGTGTGCATCCTGAATAATTT
CCAGAGTGGATTGACTTTATAATTAGAGGTCACGAGGTAACATATTAATTAAAAATAATC
GTAATCCATATAATTTTTTTTAACTGAAAGCATGAATAAAAAGATGATATAGATATTATG
AAAGAATGTCCTATTGCTACTATTTAACCTGGCTCTACTATATTAACAGCAATAGAAGAT
GTTTAGGCAACACCAAGAAGAGCTATATTATTTGAAATAAAAGGCCTTGAAGCTAACTTT
TAAGATATTACTCTAATTTAATCATATAGGCCAGTTTTATATGAGCATGTTGAATTAACT
AGTGTAGTAAAAAAAGCAGGATTCGATTTAGATAATGAAGTACCTGCAGATTAGGCTGTA
GAAGAAGTTCTATGGCAATTTATTTAACAGTCTATCAACAATTTTAAAATAGTCTTGAAA
GAAAATTTTCCAAACAGTCCTCATTTATTTGCTAAAAAACCTATTTTAAGATTTAAAATT
GAGCAAAGCAATTTTGATGTTTTTAACTTTCAAAGGTAAATAAATGCTTAAAAAATTATT
TCTTAAAAGCTTGTTTGAATATTTTTATTATCAAAAATCATTTATTATTTTCATGATTTA
TGATTTTTGTTACAATCCAATCAAAGATTAATTTAATTTTAATTAAATTTTCAATTTATT
CATTCATATATAAACTTTTTATTTAAAAATTTTCTTTAAATTGTACAAATGCTTTTTTGT
TTTAATAATGCTTATTAAATTAAATTAAAAGAATAGAATCTAAACTGTCAGACTTGGTTG
CAAATCCAGGTGAAGTGCTTAAATTTTGGAAAAGAATAATAATTAATCCTAAAACTATTA
AAAATCCAAAATTAGAAGAAGATTTTATCAAAACTTTAAAAGGAAAATCAGATTTTGATA
CAATAGGTAATGAAACTGTCAAGGATATTAAAGAATTATATGAAGATAGGATTAAAAAAA
ATAAATCTATTTCATGCCTGCCGAGCAGTCTTATAATGGATACCCTTGAAAAAGTTAATT
TGAGGAATAGAAACTCTTCTATAGAAGACATAATCAAGAATTTACAAAATAAATTACAGG
AAAATGTAGCTGTTTAGGAGGAGAAAGAAATAAGGAAGGTTAATGAACAATATCGTTAAT
AAATGAACAGCGTTTTATAAAAAATATCTACTAATATTGATGAGAGATAAAAAGATAAAA
TAGATCTTGACTTAAAAAACAGTGATAAAATTATATACAAAACTTTGATGAACAATTAAT
TTGATGATCTGAAACAAAGTTTAAATGAGAAAATAAGGACAAAAGTGGCTGAGCTATTCA
TTCAAGACTTTTAATAGGATGGAGATAATGATATTGATATAGAAAATAATAGTGATGGCT
AATATAAGGAAAGTAGTACAAATAAAAAAAGTTTGAATTCTGATTAAATGGATAGTGAAG
AAGAAGATAATAAAACTAGTAAAGTTAAAGGACGAGGAAGAAAAAGAACTGAAAATAAAT
CTATCACAACGAAAAAGTAAGTCAAGGACTTTGAATTAGAAGATAATGATTATGAAAATG
AAAATATACATGATGAGGAAGATGAAAATTAAATTTCATAATAGAAAGGATTTAAAGGCA
AATTTAAGAATAGCAAATTAGCCAAAGAAAAGGCAAACTAAAACTTGAAAAATAGATAAG
AAATAAAAGTTGAAGATTCAAGTGATCAAGATGAAGAAAAAATTGAAAAAGTAAATAGAA
GAATAAAAAAAAGTGATAATAAAAGAGATTTCAATGCTGAAAATGAAAAACCTAATATGA
AAAGTGGGTTTAAATAAAAAATGACATACGCTCAGTTATTCAAGAAATAAAATAGAATGG
ATTAAGAAGAAGAAGAAGACTATGAAGAAAATTAATAAAGTGATGAAGATGCTTCACAGC
AATCAGATTGTGAATTTGGGTTAAATGGAGAGAAATAAAAAATTAGTTATAATATTGCTC
ATATTTCTGAAATACAAAAAAAGAACTAAAGCAATAAGTCTCTTCCATTATTGCAAGTTC
AATAAAAGAAAGAATAAAGTAGTGCTATTAAGATAGAGAATTCTAGCAATACTAGGCAGA
GTATTTTAAGCAAAAAAAAGCCCCAAGCACCACAAGATGAGCCAAGAAGAGAGTAAAAAG
AGCTGGATATAAGAGAATTGATGATGAAAAGAATGAATTAAGCAAATGTTAAAAATTGA