Identifiers and Description

Gene Model Identifier

TTHERM_00622790

Standard Name

MPP10 (U3 small nucleolar ribonucleoprotein protein MPP10)

Aliases

PreTt07366 | 87.m00146 | 3814.m00852

Description

Mpp10 protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.9%

TetraMine Data

TTHERM_00622790

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_11952.19.997093137033517e-262Mpp10 protein (639 aa)
DictyBaseDDB_G02792455.999781043483669e-32mpp10 on chromosome: 3 positio
n 1824604 to 1827101
OxytrichaContig21586.0.g1001.9996410647472548e-29Mpp10 protein
SGDYJR002W1.0004572433669413e-23MPP10 Component of the SSU pro
cessome and 90S preribosome, r
equired for pre-18S rRNA proce
ssing, interacts with and cont
rols the stability of Imp3p an
d Imp4p, essential for viabili
ty; similar to human Mpp10p
Stentor CoeruleusSteCoe_288361.4251640827409352e-21
WormBaseWBGene000135442.0002795641672355e-21status:Partially_confirmed U
niProt:Q9XW58 protein_id:CAA
22114.1

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00622790(coding)
ATGAGTACAGCTAATTTTGATTTAATACATTCTTTTTCAAAGAATTTGATAAGTTAACCA
TAGATTATTGTAGAAAATGAGGATGATAAGGTCTCAAAATAAGCTCTTTCTATGATTAAA
TAATTGCATGATAATTTGATTAATCAAAGTAAAAAATTTAAAATAAAAAATGAAAATCTC
GTAGTTAAAAATATGAATGAAGAATAAATATGGGAACAAATAAATATTCATTTAGATACC
CTTGATAAGGCATTCGAAAAATACATTAATACTCTTCCTGAAGAGAAAGAATCTTAGTAA
TCTGATGATGAAATTGATGATAGTATAGATATGGATCTTGAAAAATCAAAATCAAAATCA
AAGTCTTTGAAAAAATAAAAAAAATAATTAGAAGACTCAGATAATGATGATGATGATGAC
GATGAAGAAGATGATGGCAATCTTCATTTAGAATCAGAGTATGAAGATGATGAAAGCGAA
TAGGAATAAGGATAAAAATAAAAAAATTAAAAATCACTCAAAAAATAAAAGGATCAATAA
GTAGAAGATGAAGATGAAGATGCTGAAGATGATGAAGAAGAAGATGATGATGATGATATT
GATGCAGACATTGATGCAAAAGATTTCTTTGATAATGGTGATGAAAAAGATGAAAAAGAT
GAAAAAGACTATGAAGAGTAGTTAGATTTTAAAGAAATGGAAGCTTTCTTAGATAAGTAA
GATGCTGAAGACATTGAGAGAGATAGTGAAGTTGAAGAAGAGTTAGGAAGTGATTATGAA
TTAGATGATGGCGATTCAATGATGGGAGAAGGCGAAAACGGATTTAAATTTAAGGGAAAA
GACGATTATGATGAAATGGAAGAAGAAGAAGGTGAGGGTGATAATGAAGAAAATGAAAAA
CTCCGTGAATAGGATTATGATGCAGAAGATGAAATTTTTGATTTAGAAAGAGAGCATGAA
ATAAATTAAGAAAATAAAAAAGATGAGGATATGGAAAAGTTAAGGAATGATGATGAAATT
GATAGATTAGAAAAAAGACTAATTGATGAAAAAGTATGGCTTCTTAAGGGTGAAGCTAAT
GCTAAGCATAGACCTGTTAATAGTTTATTAGACTAAGAAGTTGATTTTAGAAAAAATATT
AAAGTTACTTAAGAAATAGATGAAAAATATAATAAGAATTTAGAAGCTATTATTAAATAG
CGTATTCTAGATGAAGCATATGATGATAGATAAAAAATTAACATAGAATAAAATTTCAAG
GAAACTTTTAATAGTTTTGCAGAAATATCTAAAGAATAAAGTAAGTTAGGTTTAGGAGAA
CTTTATGAACAAGATTTTAAGAACAGCTTAGGACTTCCTTCCAACAATAAAGAAGATAAG
CTTAAATTAGAAATACATAATCTTTTTAAGGAAGTTTGCTACAAGTTGGATGCATTATCT
AACTTGAGCTTTACACCTAAACCTATTATGCAATAAGCTTAAATAACTACTAATGTACCC
TCTTTAAAACATGAAGAGAGAATACCAATTAGTGTTTCTTAAGCAGACACTTAACGTCCT
GAAGAAGTATTTGATAAAAAGAAACAAGTTACTCACTAAAGTAAGGTAGAGATGACACAC
GAAGAAAAGCAAACAGAAAGAAGATAAAAGAAATCTGCTCAAAGATAGAGAAATAAAGAA
AAGGAAAAGAAAAACCTAATTAAAAACTTATAATATAAGGGATAAACTAAATTTGAGTAT
AACTAATCTCAAAAAGCCAAAGCAAATGCCAAGAAATTGGTAGAAAATAAAAGATAAAAG
AGTGTAGAATTTACCAAATCAAGCGAATTCTTTAGGAACATGCAAAATAACTAATAGTTA
GAAGCTTCTGGTAAAAATAATTAGGCTGGAAATAAAACTAAATCTATTAAAAAAAAATCC
AAATGA


>TTHERM_00622790(protein)
MSTANFDLIHSFSKNLISQPQIIVENEDDKVSKQALSMIKQLHDNLINQSKKFKIKNENL
VVKNMNEEQIWEQINIHLDTLDKAFEKYINTLPEEKESQQSDDEIDDSIDMDLEKSKSKS
KSLKKQKKQLEDSDNDDDDDDEEDDGNLHLESEYEDDESEQEQGQKQKNQKSLKKQKDQQ
VEDEDEDAEDDEEEDDDDDIDADIDAKDFFDNGDEKDEKDEKDYEEQLDFKEMEAFLDKQ
DAEDIERDSEVEEELGSDYELDDGDSMMGEGENGFKFKGKDDYDEMEEEEGEGDNEENEK
LREQDYDAEDEIFDLEREHEINQENKKDEDMEKLRNDDEIDRLEKRLIDEKVWLLKGEAN
AKHRPVNSLLDQEVDFRKNIKVTQEIDEKYNKNLEAIIKQRILDEAYDDRQKINIEQNFK
ETFNSFAEISKEQSKLGLGELYEQDFKNSLGLPSNNKEDKLKLEIHNLFKEVCYKLDALS
NLSFTPKPIMQQAQITTNVPSLKHEERIPISVSQADTQRPEEVFDKKKQVTHQSKVEMTH
EEKQTERRQKKSAQRQRNKEKEKKNLIKNLQYKGQTKFEYNQSQKAKANAKKLVENKRQK
SVEFTKSSEFFRNMQNNQQLEASGKNNQAGNKTKSIKKKSK


>TTHERM_00622790(gene)
ATGAGTACAGCTAATTTTGATTTAATACATTCTTTTTCAAAGAATTTGATAAGTTAACCA
TAGATTATTGTAGAAAATGAGGATGATAAGGTCTCAAAATAAGCTCTTTCTATGATTAAA
TAATTGCATGATAATTTGATTAATCAAAGTAAAAAATTTAAAATAAAAAATGAAAATCTC
GTAGTTAAAAATATGAATGAAGAATAAATATGGGAACAAATAAATATTCATTTAGATACC
CTTGATAAGGCATTCGAAAAATACATTAATACTCTTCCTGAAGAGAAAGAATCTTAGTAA
TCTGATGATGAAATTGATGATAGTATAGATATGGATCTTGAAAAATCAAAATCAAAATCA
AAGTCTTTGAAAAAATAAAAAAAATAATTAGAAGACTCAGATAATGATGATGATGATGAC
GATGAAGAAGATGATGGCAATCTTCATTTAGAATCAGAGTATGAAGATGATGAAAGCGAA
TAGGAATAAGGATAAAAATAAAAAAATTAAAAATCACTCAAAAAATAAAAGGATCAATAA
GTAGAAGATGAAGATGAAGATGCTGAAGATGATGAAGAAGAAGATGATGATGATGATATT
GATGCAGACATTGATGCAAAAGATTTCTTTGATAATGGTGATGAAAAAGATGAAAAAGAT
GAAAAAGACTATGAAGAGTAGTTAGATTTTAAAGAAATGGAAGCTTTCTTAGATAAGTAA
GATGCTGAAGACATTGAGAGAGATAGTGAAGTTGAAGAAGAGTTAGGAAGTGATTATGAA
TTAGATGATGGCGATTCAATGATGGGAGAAGGCGAAAACGGATTTAAATTTAAGGGAAAA
GACGATTATGATGAAATGGAAGAAGAAGAAGGTGAGGGTGATAATGAAGAAAATGAAAAA
CTCCGTGAATAGGATTATGATGCAGAAGATGAAATTTTTGATTTAGAAAGAGAGCATGAA
ATAAATTAAGAAAATAAAAAAGATGAGGATATGTAAAATTTATGTTTCAATTATCACAAT
TTGCATGTTATTTTTAAAAATTATTTAATAGGGAAAAGTTAAGGAATGATGATGAAATTG
ATAGATTAGAAAAAAGACTAATTGATGAAAAAGTATGGCTTCTTAAGGGTGAAGCTAATG
CTAAGCATAGACCTGTTAATAGTTTATTAGACTAAGAAGTTGATTTTAGAAAAAATATTA
AAGTTACTTAAGAAATAGATGAAAAATATAATAAGAATTTAGAAGCTATTATTAAATAGC
GTATTCTAGATGAAGCATATGATGATAGATAAAAAATTAACATAGAATAAAATTTCAAGG
AAACTTTTAATAGTTTTGCAGAAATATCTAAAGAATAAAGTAAGTTAGGTTTAGGAGAAC
TTTATGAACAAGATTTTAAGAACAGCTTAGGACTTCCTTCCAACAATAAAGAAGATAAGC
TTAAATTAGAAATACATAATCTTTTTAAGGAAGTTTGCTACAAGTTGGATGCATTATCTA
ACTTGAGCTTTACACCTAAACCTATTATGCAATAAGCTTAAATAACTACTAATGTACCCT
CTTTAAAACATGAAGAGAGAATACCAATTAGTGTTTCTTAAGCAGACACTTAACGTCCTG
AAGAAGTATTTGATAAAAAGAAACAAGTTACTCACTAAAGTAAGGTAGAGATGACACACG
AAGAAAAGCAAACAGAAAGAAGATAAAAGAAATCTGCTCAAAGATAGAGAAATAAAGAAA
AGGAAAAGAAAAACCTAATTAAAAACTTATAATATAAGGGATAAACTAAATTTGAGTATA
ACTAATCTCAAAAAGCCAAAGCAAATGCCAAGAAATTGGTAGAAAATAAAAGATAAAAGA
GTGTAGAATTTACCAAATCAAGCGAATTCTTTAGGAACATGCAAAATAACTAATAGTTAG
AAGCTTCTGGTAAAAATAATTAGGCTGGAAATAAAACTAAATCTATTAAAAAAAAATCCA
AATGA