Identifiers and Description

Gene Model Identifier

TTHERM_00622790

Standard Name

MPP10 (U3 small nucleolar ribonucleoprotein protein MPP10)

Aliases

PreTt07366 | 87.m00146 | 3814.m00852

Description

MPP10 Mpp10 protein; Mpp10 protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.9%

TetraMine Data

TTHERM_00622790

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_11952.19.997093137033517e-262Mpp10 protein (639 aa)
DictyBaseDDB_G02792455.999781043483669e-32mpp10 on chromosome: 3 positio
n 1824604 to 1827101
OxytrichaContig21586.0.g1001.9996410647472548e-29Mpp10 protein
SGDYJR002W1.0004572433669413e-23MPP10 Component of the SSU pro
cessome and 90S preribosome, r
equired for pre-18S rRNA proce
ssing, interacts with and cont
rols the stability of Imp3p an
d Imp4p, essential for viabili
ty; similar to human Mpp10p
Stentor CoeruleusSteCoe_288361.4251640827409352e-21
WormBaseWBGene000135442.0002795641672355e-21status:Partially_confirmed U
niProt:Q9XW58 protein_id:CAA
22114.1

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00622790(coding)
ATGAGTACAGCTAATTTTGATTTAATACATTCTTTTTCAAAGAATTTGATAAGTTAACCA
TAGATTATTGTAGAAAATGAGGATGATAAGGTCTCAAAATAAGCTCTTTCTATGATTAAA
TAATTGCATGATAATTTGATTAATCAAAGTAAAAAATTTAAAATAAAAAATGAAAATCTC
GTAGTTAAAAATATGAATGAAGAATAAATATGGGAACAAATAAATATTCATTTAGATACC
CTTGATAAGGCATTCGAAAAATACATTAATACTCTTCCTGAAGAGAAAGAATCTTAGTAA
TCTGATGATGAAATTGATGATAGTATAGATATGGATCTTGAAAAATCAAAATCAAAATCA
AAGTCTTTGAAAAAATAAAAAAAATAATTAGAAGACTCAGATAATGATGATGATGATGAC
GATGAAGAAGATGATGGCAATCTTCATTTAGAATCAGAGTATGAAGATGATGAAAGCGAA
TAGGAATAAGGATAAAAATAAAAAAATTAAAAATCACTCAAAAAATAAAAGGATCAATAA
GTAGAAGATGAAGATGAAGATGCTGAAGATGATGAAGAAGAAGATGATGATGATGATATT
GATGCAGACATTGATGCAAAAGATTTCTTTGATAATGGTGATGAAAAAGATGAAAAAGAT
GAAAAAGACTATGAAGAGTAGTTAGATTTTAAAGAAATGGAAGCTTTCTTAGATAAGTAA
GATGCTGAAGACATTGAGAGAGATAGTGAAGTTGAAGAAGAGTTAGGAAGTGATTATGAA
TTAGATGATGGCGATTCAATGATGGGAGAAGGCGAAAACGGATTTAAATTTAAGGGAAAA
GACGATTATGATGAAATGGAAGAAGAAGAAGGTGAGGGTGATAATGAAGAAAATGAAAAA
CTCCGTGAATAGGATTATGATGCAGAAGATGAAATTTTTGATTTAGAAAGAGAGCATGAA
ATAAATTAAGAAAATAAAAAAGATGAGGATATGGAAAAGTTAAGGAATGATGATGAAATT
GATAGATTAGAAAAAAGACTAATTGATGAAAAAGTATGGCTTCTTAAGGGTGAAGCTAAT
GCTAAGCATAGACCTGTTAATAGTTTATTAGACTAAGAAGTTGATTTTAGAAAAAATATT
AAAGTTACTTAAGAAATAGATGAAAAATATAATAAGAATTTAGAAGCTATTATTAAATAG
CGTATTCTAGATGAAGCATATGATGATAGATAAAAAATTAACATAGAATAAAATTTCAAG
GAAACTTTTAATAGTTTTGCAGAAATATCTAAAGAATAAAGTAAGTTAGGTTTAGGAGAA
CTTTATGAACAAGATTTTAAGAACAGCTTAGGACTTCCTTCCAACAATAAAGAAGATAAG
CTTAAATTAGAAATACATAATCTTTTTAAGGAAGTTTGCTACAAGTTGGATGCATTATCT
AACTTGAGCTTTACACCTAAACCTATTATGCAATAAGCTTAAATAACTACTAATGTACCC
TCTTTAAAACATGAAGAGAGAATACCAATTAGTGTTTCTTAAGCAGACACTTAACGTCCT
GAAGAAGTATTTGATAAAAAGAAACAAGTTACTCACTAAAGTAAGGTAGAGATGACACAC
GAAGAAAAGCAAACAGAAAGAAGATAAAAGAAATCTGCTCAAAGATAGAGAAATAAAGAA
AAGGAAAAGAAAAACCTAATTAAAAACTTATAATATAAGGGATAAACTAAATTTGAGTAT
AACTAATCTCAAAAAGCCAAAGCAAATGCCAAGAAATTGGTAGAAAATAAAAGATAAAAG
AGTGTAGAATTTACCAAATCAAGCGAATTCTTTAGGAACATGCAAAATAACTAATAGTTA
GAAGCTTCTGGTAAAAATAATTAGGCTGGAAATAAAACTAAATCTATTAAAAAAAAATCC
AAATGA


>TTHERM_00622790(protein)
MSTANFDLIHSFSKNLISQPQIIVENEDDKVSKQALSMIKQLHDNLINQSKKFKIKNENL
VVKNMNEEQIWEQINIHLDTLDKAFEKYINTLPEEKESQQSDDEIDDSIDMDLEKSKSKS
KSLKKQKKQLEDSDNDDDDDDEEDDGNLHLESEYEDDESEQEQGQKQKNQKSLKKQKDQQ
VEDEDEDAEDDEEEDDDDDIDADIDAKDFFDNGDEKDEKDEKDYEEQLDFKEMEAFLDKQ
DAEDIERDSEVEEELGSDYELDDGDSMMGEGENGFKFKGKDDYDEMEEEEGEGDNEENEK
LREQDYDAEDEIFDLEREHEINQENKKDEDMEKLRNDDEIDRLEKRLIDEKVWLLKGEAN
AKHRPVNSLLDQEVDFRKNIKVTQEIDEKYNKNLEAIIKQRILDEAYDDRQKINIEQNFK
ETFNSFAEISKEQSKLGLGELYEQDFKNSLGLPSNNKEDKLKLEIHNLFKEVCYKLDALS
NLSFTPKPIMQQAQITTNVPSLKHEERIPISVSQADTQRPEEVFDKKKQVTHQSKVEMTH
EEKQTERRQKKSAQRQRNKEKEKKNLIKNLQYKGQTKFEYNQSQKAKANAKKLVENKRQK
SVEFTKSSEFFRNMQNNQQLEASGKNNQAGNKTKSIKKKSK


>TTHERM_00622790(gene)
ATGAGTACAGCTAATTTTGATTTAATACATTCTTTTTCAAAGAATTTGATAAGTTAACCA
TAGATTATTGTAGAAAATGAGGATGATAAGGTCTCAAAATAAGCTCTTTCTATGATTAAA
TAATTGCATGATAATTTGATTAATCAAAGTAAAAAATTTAAAATAAAAAATGAAAATCTC
GTAGTTAAAAATATGAATGAAGAATAAATATGGGAACAAATAAATATTCATTTAGATACC
CTTGATAAGGCATTCGAAAAATACATTAATACTCTTCCTGAAGAGAAAGAATCTTAGTAA
TCTGATGATGAAATTGATGATAGTATAGATATGGATCTTGAAAAATCAAAATCAAAATCA
AAGTCTTTGAAAAAATAAAAAAAATAATTAGAAGACTCAGATAATGATGATGATGATGAC
GATGAAGAAGATGATGGCAATCTTCATTTAGAATCAGAGTATGAAGATGATGAAAGCGAA
TAGGAATAAGGATAAAAATAAAAAAATTAAAAATCACTCAAAAAATAAAAGGATCAATAA
GTAGAAGATGAAGATGAAGATGCTGAAGATGATGAAGAAGAAGATGATGATGATGATATT
GATGCAGACATTGATGCAAAAGATTTCTTTGATAATGGTGATGAAAAAGATGAAAAAGAT
GAAAAAGACTATGAAGAGTAGTTAGATTTTAAAGAAATGGAAGCTTTCTTAGATAAGTAA
GATGCTGAAGACATTGAGAGAGATAGTGAAGTTGAAGAAGAGTTAGGAAGTGATTATGAA
TTAGATGATGGCGATTCAATGATGGGAGAAGGCGAAAACGGATTTAAATTTAAGGGAAAA
GACGATTATGATGAAATGGAAGAAGAAGAAGGTGAGGGTGATAATGAAGAAAATGAAAAA
CTCCGTGAATAGGATTATGATGCAGAAGATGAAATTTTTGATTTAGAAAGAGAGCATGAA
ATAAATTAAGAAAATAAAAAAGATGAGGATATGTAAAATTTATGTTTCAATTATCACAAT
TTGCATGTTATTTTTAAAAATTATTTAATAGGGAAAAGTTAAGGAATGATGATGAAATTG
ATAGATTAGAAAAAAGACTAATTGATGAAAAAGTATGGCTTCTTAAGGGTGAAGCTAATG
CTAAGCATAGACCTGTTAATAGTTTATTAGACTAAGAAGTTGATTTTAGAAAAAATATTA
AAGTTACTTAAGAAATAGATGAAAAATATAATAAGAATTTAGAAGCTATTATTAAATAGC
GTATTCTAGATGAAGCATATGATGATAGATAAAAAATTAACATAGAATAAAATTTCAAGG
AAACTTTTAATAGTTTTGCAGAAATATCTAAAGAATAAAGTAAGTTAGGTTTAGGAGAAC
TTTATGAACAAGATTTTAAGAACAGCTTAGGACTTCCTTCCAACAATAAAGAAGATAAGC
TTAAATTAGAAATACATAATCTTTTTAAGGAAGTTTGCTACAAGTTGGATGCATTATCTA
ACTTGAGCTTTACACCTAAACCTATTATGCAATAAGCTTAAATAACTACTAATGTACCCT
CTTTAAAACATGAAGAGAGAATACCAATTAGTGTTTCTTAAGCAGACACTTAACGTCCTG
AAGAAGTATTTGATAAAAAGAAACAAGTTACTCACTAAAGTAAGGTAGAGATGACACACG
AAGAAAAGCAAACAGAAAGAAGATAAAAGAAATCTGCTCAAAGATAGAGAAATAAAGAAA
AGGAAAAGAAAAACCTAATTAAAAACTTATAATATAAGGGATAAACTAAATTTGAGTATA
ACTAATCTCAAAAAGCCAAAGCAAATGCCAAGAAATTGGTAGAAAATAAAAGATAAAAGA
GTGTAGAATTTACCAAATCAAGCGAATTCTTTAGGAACATGCAAAATAACTAATAGTTAG
AAGCTTCTGGTAAAAATAATTAGGCTGGAAATAAAACTAAATCTATTAAAAAAAAATCCA
AATGA