Identifiers and Description

Gene Model Identifier

TTHERM_00195990

Standard Name

MPK9 (Mitogen-activated Protein Kinase)

Aliases

PreTt06784 | 16.m00440 | XP_001017253

Description

Serine/Threonine kinase domain protein; Protein kinase domain containing protein. Sequence similarity to the ERK subfamily of the protein kinase MAPK family (Eisen et al.- 2006).

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10%

TetraMine Data

TTHERM_00195990

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Stentor CoeruleusSteCoe_316540
Tetrahymena borealisEI9_03777.19.997093137033517e-262protein kinase domain-containi
ng protein (612 aa)
OxytrichaContig19712.0.g799.997093137033517e-262Protein kinase domain
DictyBaseDDB_G02863531.0002323021920326e-132erkA on chromosome: 4 position
4355028 to 4356796
WormBaseWBGene000034019.002752962930884e-112locus:mpk-1 Mitogen-activate
d protein kinase mpk-1 statu
s:Partially_confirmed UniPro
t:P39745 protein_id:CAB60996
.1
SGDYBL016W1.999745369828301e-106FUS3 Mitogen-activated serine/
threonine protein kinase invol
ved in mating; phosphoactivate
d by Ste7p; substrates include
Ste12p, Far1p, Bni1p, Sst2p;
inhibits invasive growth durin
g mating by phosphorylating Te
c1p, promoting its degradation

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:25286252: Yıldız MT, Arslanyolu M (2014) In silico identification and characterization of the MAPK family members of unicellular model eukaryote Tetrahymena thermophila. European journal of protistology 50(5):538-50
  2. Ref:16933976: Eisen JA, Coyne RS, Wu M, Wu D, Thiagarajan M, Wortman JR, Badger JH, Ren Q, Amedeo P, Jones KM, Tallon LJ, Delcher AL, Salzberg SL, Silva JC, Haas BJ, Majoros WH, Farzad M, Carlton JM, Smith RK, Garg J, Pearlman RE, Karrer KM, Sun L, Manning G, Elde NC, Turkewitz AP, Asai DJ, Wilkes DE, Wang Y, Cai H, Collins K, Stewart BA, Lee SR, Wilamowska K, Weinberg Z, Ruzzo WL, Wloga D, Gaertig J, Frankel J, Tsao CC, Gorovsky MA, Keeling PJ, Waller RF, Patron NJ, Cherry JM, Stover NA,

Sequences

>TTHERM_00195990(coding)
ATGAAAGGATAGAGTATGTATTAAAATAGTAATAATACAAGTGGTAATAACTTTAGCTAT
ATGAATTATAACTAAAATCAAAGCATTCCATCTTCGTATTATTAATAGCAATAGAATTAG
CAATCTTCCTAATAACCTTTACAGCAGTAAAATCAAAATATTACTTCTTATTCTCGTTCT
TAGAGTCGCCACTCTCATCACTAAAGCGAAAATGTTAACATTTCTGCTACAAACAATACC
AATAACATGCAATCTTAAAATTAAAAATATGTTAAATAATCTACTTCTTCTATGTCTCAC
ACATAATCAAACCAAGTGTATTAAAATTCTTAGCTAAGGGAAAACTATAATAATCTTAGT
AATAATAGTAATGCCAAATCAAGTTAAATTTAATCATCTCAAACTGGAAATATACGCCCT
TCAACCGTTGCTAACATTTTGAATAACAACTCCACAAATAAAATAAGTTAAAATACCATT
TAAAATTTAAAGCAAACAAACTAAGTAATTCCCAACAACTCCAAGGTTAACAATGAAAAT
AGAGTTCAGAATAATACAATAACAAGCAATTAAAATACTTTGACAAACAATACTAATAAT
GTTATATCTAGTTCTATTAATGCTAACAACAATAATTAGTAATCAAATAACCAGTAAATT
TCTTCGATCTCTGCCTCACTAAAAGCTAGCACTACAAACACCAAAAATCAAATTTAAAAA
AAGAGAAAGACTTTTGAATGTGGAGGTACTGCATTTAGTGTTGATGATCATTACGAGTTC
CACAAATAAATAGGACACGGCGCCTATGGTGTTGTTTGCTCTGGAGTTGACACAAAATGC
AATAAAAAAATTGCTATAAAAAAAATAACAAATGCTTTTGAAGATTTAGTTGATGCAAAA
AGAATCGTTAGAGAGATTAAAATGTTAAAATTTTTTGACCATGAGAATATTATTGCTCTT
CATGACATTATAGTACCAGAATAGAGAACTGACTATAATGATATTTATATTGTCACCGAG
CTTATGGAAACAGATCTCCATAGAGTTATATACTCCCGCCAAGAGTTAACTGATGATCAC
ATTCAATACTTTTTATATCAAACTCTACGTGGTATGCTTTACATCCATTCTGCAAATGTT
ATGCATAGAGATTTGAAACCTTCTAATATTCTTGTTAATAAAAATTGTGACCTCAAAGTT
TGTGATTTAGGTCTTGCAAGAGGTTTCGAATTTGATGAAGAAGATGGAAAAACAGAGTAT
GTTGTTACAAGATGGTATAGAGCCCCAGAAGTTATCTTGAAGGCTTCTAAATACACAAAA
TCTATTGATGTGTGGTCTATTGGGTGTATATTTGCAGAATTACTAGGTAGAACTCCACTC
TTCCCAGGAAAGGATTACCTTGAATAAATATAAAGAATTATTGCAATTTTAGGTACTCCT
ACTCCTGAAGAGTTAAGCTATATAACTAATGAAGGAGCATTAAAATATTTGAAAAGTCTT
CCTAAAAGAACTAAGCAAAGTTGGGAAAATCTTTATCCTAATGCTAATTTAGTAGGTTTA
GATCTTTTATCTAAAATGCTAACATTTAATCCCAATGATCGTTACACAATTGAAGAATGT
CTCGCTCATCCTTACTTTGAAGGTCTTCATAATCCTGAAGACGAGCCTACTTGTCCTGAA
GTATTTGATTGGGCATGGGATGATTTCGAGCTAACCAAAGAAAGGTTGCAAGGTATGGTT
TATGATGAAGCTATAGACTATCAAAAAGTAAAAGCAACTTAATAATAATAATATTAATAA
TAACAATCTTATGAAAATTAATGTTGA


>TTHERM_00195990(protein)
MKGQSMYQNSNNTSGNNFSYMNYNQNQSIPSSYYQQQQNQQSSQQPLQQQNQNITSYSRS
QSRHSHHQSENVNISATNNTNNMQSQNQKYVKQSTSSMSHTQSNQVYQNSQLRENYNNLS
NNSNAKSSQIQSSQTGNIRPSTVANILNNNSTNKISQNTIQNLKQTNQVIPNNSKVNNEN
RVQNNTITSNQNTLTNNTNNVISSSINANNNNQQSNNQQISSISASLKASTTNTKNQIQK
KRKTFECGGTAFSVDDHYEFHKQIGHGAYGVVCSGVDTKCNKKIAIKKITNAFEDLVDAK
RIVREIKMLKFFDHENIIALHDIIVPEQRTDYNDIYIVTELMETDLHRVIYSRQELTDDH
IQYFLYQTLRGMLYIHSANVMHRDLKPSNILVNKNCDLKVCDLGLARGFEFDEEDGKTEY
VVTRWYRAPEVILKASKYTKSIDVWSIGCIFAELLGRTPLFPGKDYLEQIQRIIAILGTP
TPEELSYITNEGALKYLKSLPKRTKQSWENLYPNANLVGLDLLSKMLTFNPNDRYTIEEC
LAHPYFEGLHNPEDEPTCPEVFDWAWDDFELTKERLQGMVYDEAIDYQKVKATQQQQYQQ
QQSYENQC


>TTHERM_00195990(gene)
ATGAAAGGATAGAGTATGTATTAAAATAGTAATAATACAAGTGGTAATAACTTTAGCTAT
ATGAATTATAACTAAAATCAAAGCATTCCATCTTCGTATTATTAATAGCAATAGAATTAG
CAATCTTCCTAATAACCTTTACAGCAGTAAAATCAAAATATTACTTCTTATTCTCGTTCT
TAGAGTCGCCACTCTCATCACTAAAGCGAAAATGTTAACATTTCTGCTACAAACAATACC
AATAACATGCAATCTTAAAATTAAAAATATGTTAAATAATCTACTTCTTCTATGTCTCAC
ACATAATCAAACCAAGTGTATTAAAATTCTTAGCTAAGGGAAAACTATAATAATCTTAGT
AATAATAGTAATGCCAAATCAAGTTAAATTTAATCATCTCAAACTGGAAATATACGCCCT
TCAACCGTTGCTAACATTTTGAATAACAACTCCACAAATAAAATAAGTTAAAATACCATT
TAAAATTTAAAGCAAACAAACTAAGTAATTCCCAACAACTCCAAGGTTAACAATGAAAAT
AGAGTTCAGAATAATACAATAACAAGCAATTAAAATACTTTGACAAACAATACTAATAAT
GTTATATCTAGTTCTATTAATGCTAACAACAATAATTAGTAATCAAATAACCAGTAAATT
TCTTCGATCTCTGCCTCACTAAAAGCTAGCACTACAAACACCAAAAATCAAATTTAAAAA
AAGAGAAAGACTTTTGAATGTGGAGGTAAAGTTATTTTAGCTTTTAAAAAAAATTTTTAG
ATTAAGGCAACTTAGCAATATAATTAAAACAAACAAATTCTTTGTAACTATAATTAACAT
TTTTATTATAATAGGTACTGCATTTAGTGTTGATGATCATTACGAGTTCCACAAATAAAT
AGGACACGGCGCCTATGGTGTTGTTTGCTCTGGAGTTGACACAAAATGCAATAAAAAAAT
TGCTATAAAAAAAGTAATTAATAACAATGAATTTATTTATTTTCTTTGCATTTACTAACA
ATTTATTTGTTAAAAAAATTTAATTGGATGTTATTTTTGATAGATTTTAGAAGTATCTAT
CTATCTATATATCTCTTTAACAATGTTAAAAGAGATTTGTAATTTAATTAATGCAAAAAA
AAAAATATTAACATTCTTTTCTAATCTGATTTCAAAATTAATTATAAATTAATTAATTAA
TAAATGCTTTTTCTTCAATTATTTATGATTATTAAAGAAATGAGTTGTTAGATTTTTCAC
TATATTTTATTTCCCAAAGATTTAATTTTAATTACAAAAACAAATGTCTAACTGATTAAT
TTTTAGGTTTTAAAGCCAATAATAATTTACTTTTCATCGAATTTTATTAGCCTCAATATT
TTTTTTTGCTGAAGATCAAATAAGCTGATAAATATAATTTATTTATTGAATAATTAGATA
ACAAATGCTTTTGAAGATTTAGTTGATGCAAAAAGAATCGTTAGAGAGATTAAAATGTTA
AAATTTTTTGACCATGAGAATATTATTGCTCTTCATGACATTATAGTACCAGAATAGAGA
ACTGACTATAATGATATTTATATTGTCACCGAGCTTATGGAAACAGATCTCCATAGAGTT
ATATACTCCCGCCAAGTAATTAAATTACTTTATTTCTTTCTATTTATATTTTTTTACTGA
AATTCACAATTAAGTTTTTAAAAATATGAATTGATTTGTTTATTAATTTTAAACTAAACT
TTTTAACTCAAATTATTAGGAGTTAACTGATGATCACATTCAATACTTTTTATATCAAAC
TCTACGTGGTATGCTTTACATCCATTCTGCAAATGTTATGCATAGAGATTTGAAACCTTC
TAATATTCTTGTTAATAAAAATTGTGACCTCAAAGTTTGTGATTTAGGTCTTGCAAGAGG
TTTCGAATTTGATGAAGAAGATGGAAAAACAGAGTAATTAATTTTTCATATTATATTTGT
AGCTTTTGTAAAATTGGGAAAAAAATAGTAAAATAAATTTTTTAATTTATATTAATTTTA
GGTATGTTGTTACAAGATGGTATAGAGCCCCAGAAGTTATCTTGAAGGCTTCTAAATACA
CAAAATCTATTGATGTGTGGTCTATTGGGTGTATATTTGCAGAATTACTAGGTAGAACTC
CACTCTTCCCAGGAAAGGATTACCTTGAATAAATATAAAGAATTATTGCAATTTTAGGTA
CTCCTACTCCTGAAGAGTTAAGCTATATAACTAATGAAGGAGCATTAAAATATTTGAAAA
GTCTTCCTAAAAGAACTAAGCAAAGTTGGGAAAATCTTTATCCTAATGCTAATTTAGTAG
GTTTAGATCTTTTATCTAAAATGCTAACATTTAATCCCAATGATCGTTACACAATTGAAG
AATGTCTCGCTCATCCTTACTTTGAAGGTCTTCATAATCCTGAAGACGAGCCTACTTGTC
CTGAAGTATTTGATTGGGCATGGGATGATTTCGAGCTAACCAAAGAAAGGTTGCAAGGTA
TGGTTTATGATGAAGCTATAGACTATCAAAAAGTAAAAGCAACTTAATAATAATAATATT
AATAATAACAATCTTATGAAAATTAATGTTGA