Identifiers and Description

Gene Model Identifier

TTHERM_00492370

Standard Name

MPK8 (Mitogen-activated Protein Kinase)

Aliases

PreTt04173 | 61.m00160 | 3711.m00008 | XP_001023129

Description

Protein kinase domain containing protein. Sequence similarity to the ERK subfamily of the protein kinase MAPK family (Eisen et al., 2006)." Putative mitogen-activated ERK1/2 subfamily (MAP) kinase (Yildiz&Arslanyolu, 2014)

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( PF06994 ) Involucrin
  • ( PF02985 ) HEAT repeat
  • ( TIGR01612 ) rhoptry protein
  • ( PF08064 ) UME (NUC010) domain
  • ( PF00069 ) protein kinase domain
  • ( TIGR01257 ) rim ABC transporter
  • ( PF07714 ) protein tyrosine kinase
  • ( PF00399 ) Yeast PIR protein repeat
  • ( PF04702 ) Vicilin N terminal region
  • ( PF04740 ) Bacillus transposase protein
  • ( PF08946 ) Osmosensory transporter coiled coil
  • ( TIGR00864 ) polycystin cation channel protein
  • ( PF08939 ) Domain of unknown function (DUF1917)
  • ( TIGR01716 ) transcriptional activator, Rgg/GadR/MutR family, C-terminal

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.8%

TetraMine Data

TTHERM_00492370

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_12930.19.997093137033517e-262hypothetical protein (2012 aa)

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:25286252: Yıldız MT, Arslanyolu M (2014) In silico identification and characterization of the MAPK family members of unicellular model eukaryote Tetrahymena thermophila. European journal of protistology 50(5):538-50
  2. Ref:16933976: Eisen JA, Coyne RS, Wu M, Wu D, Thiagarajan M, Wortman JR, Badger JH, Ren Q, Amedeo P, Jones KM, Tallon LJ, Delcher AL, Salzberg SL, Silva JC, Haas BJ, Majoros WH, Farzad M, Carlton JM, Smith RK, Garg J, Pearlman RE, Karrer KM, Sun L, Manning G, Elde NC, Turkewitz AP, Asai DJ, Wilkes DE, Wang Y, Cai H, Collins K, Stewart BA, Lee SR, Wilamowska K, Weinberg Z, Ruzzo WL, Wloga D, Gaertig J, Frankel J, Tsao CC, Gorovsky MA, Keeling PJ, Waller RF, Patron NJ, Cherry JM, Stover NA,

Sequences

>TTHERM_00492370(coding)
ATGAATCTCTAAGCATAGTAAAAAACAAGAAAATAGTCGAAAGGCTAAATTTTAGAGATA
TTTGAGTAAATAAAGCCTACTCATTATATTTAAGACACTGCAAATGGTGTTTCAACCAAA
TCATTTACAAAGTAAATAAGATACCAAAGTCAGAATCCTAAAATGAGCAATTAAAAAGAA
CTTACTGACTTTCAAAGGACAGAGCTAGAAAAGCAAAAAAGGAATCAAGAGTATCTCTTT
CATATTGGAAATCATGCAAGAACTGTCAGTGATATTTTGAAGTTTAGATATGATTAATAT
AAACAAACTTTAGGGTAACAAGAGTAGTAGTCAGAAGAGTAATAAAGAATGTAGTATTAA
AATCAATAATCTATATGGTAAAACTCTACAACTATGATATAATAATACTAATAATACCAC
TAAGCATAAGAATCAAATATCAAGAGATCTAATACACTCAGCAATTTATAGAGTTAAAAA
TCAGGAGTTAAAATTTGTAATTCTGCTAGCAAATAAAGCGAAAAAAATTAAAATACATAA
AAGCTTTTATATAAGCCAGCTCAAATACAGTCTTAAAAAGCTATCTCTTCTATTTTAGGA
AGCGCTGAATCAAATATTTCACCAATAAAAAAATCTTATAATGAAGATTTGGCAACTGCA
GGAGACACAAGAGATAACTTTGCATCTTTAAGTGGAGGATCTTTAAAATCAAACCCTAAT
AATTTTTCTTTCTAAGATAGAAAATATGTTAGTGAAAAAGACTATTTATCCATTTAAAGG
AACCTTTTTGATTCTATAGACACACAAAAGAATAGTTCTATTTAAAATTAACAATGTTCT
TCAATTGTTCAATCAAAAAAAGAATCAGACGAAATAGATTTCAATAAATAATCTAAATTA
GAAAAGTAAAATAATCAAACTTTTAACAAAGAAGATAGATTATTATAATCTCCAGCATCT
TTACATTTAAATTAGAAATCATAATCATAAGATTACTTGGCATAAAAAAATCCTACATAA
TAACAATAAATGAGCCCACATCTTATTTAACCTAGCCATTTGCTCTTCGTCGACAGTCAA
TAAAATTAAAATTAGATAAATTATCCAAACCAATTTATATCAAGCATTTCATAAACCTCT
GGTTAATAAAATTAAACATAGGAATAATTCAAAATTGATTAATTCAAAAACAATCAAATA
AATAATAATTAAAAGTTTTTGAACTAAATAAATTATTCTTAATATAATTCAATTCCTTCG
CTAGATATAAGCTAAGCTTAAAATAAGGAAGGTATCATAAATACAGATATTAAGCCTATT
CAAAAATATTAAGAAAATCTGTAGTCAACCTCAACAATAGAAACTAATTAATTAGCTTAA
GCAAATAAAATTACTGAATCAAAATTTACAAATTTTGCTAAAAGTAATGATTAGTCATAA
ATGCAATCAGCCTCTGATATATATTCATTTAATTAGCCATATAGTACTAGCTAGATAAGT
TCCCAAATTCTCTCTACTGAAAGGTAATTCAAAATAAAGCTGACTAAAATTACAAAGGAT
TCTTAGATTTCGGAAGAATATCAGATAAATAAATCTCCTTCATCTTTTACTTAATTAGAA
AATAAGTAAGACCTTTTAATCAAATTCGCTGAAGCAAGAAAATAAGAGCATTTAAATAAT
TTATATGATGATGCTTAATCAGATTTTTCTAAAACTCCTTAGACAAACAAATCTGAGGTA
ATTAAAAGGTTTAAAGCTTCTCAAATTTTTGATTAAAATTAATCATAAGCAAATAGTAAG
CCAAGTTAGAATAAGTCTTCATAAATATATTACAATAATAATAGCTAGTATGATTTTGCA
AATAGTGTCAAAGAAATAAATAATGAACACAAGTACACAAATTTAATGTCATCCGCTTAA
CAATAAAACTTATCACACTAAATACCCACCTTAAGTGGAATGGGAAGAATTAACAATTTT
ATTAGAAAATCTTAAGAAGGAAACAAATAAAGCAACTATTTTACTCAAATTTCAGATTCA
TAAATTTAGAATGCCGGAAATGTTACAAAGTAATCAGCATCTTTTAATCCAAACTATCAC
TTACTAGAAAGCTATACTAATAGTTTAGTTAAACAAAATAATAATGAAACTTTAAACCCT
CTTAATACTTAAAATTAAATAAAGAATCTGATCGATTATAATAGCCCCAAATAGAATATT
TAAAATATCTAAGCATCTGGACTTTATAATCAGAGTTCATTCTAATAAGAAACAAAATCT
AGTCTTAGTATGATAAAAAATATTTTTGAGAGCACCCTAAACAACTAAGAAAATCCATCA
AATTAGAATTTAATTTCTTCATCTCCCAAGAATTTAGAATTAAATATTATTCTGAGTAAG
TATTAATCCAACAAAGAAAAATAAAATTTAAGATAAAGTTCATAATTCTAGTAATAAACA
CCTTCTATATAGTTGGAAACAAAGAACTCTTTCGCCAAAAGCATTGACTAACACTTTTCA
TAACAGAATACACGTTTATCAAATACATTAGCTGAATTAAACTAAAGTAGTTAGGTGAAA
AATAGCCTCACAGTTCTTGAAAACTAAAAAATTTAGCAAATTATGGATGATATTTAAGCC
AAAATATCTTTAAAAAAATCATAATCTTTAGAATAATCTGGTATCGCTATGTAATCATCT
TCAAATAAATTTTCATAATACTTCGAAAAGAAAACTTCAAACTCATAAGTTATTGATAAC
GGCATGAATGAGTAAAATGGTTTAATAGTTAGTTTTGCAAATAATTCTCTAGTAGGTTAA
TCTACAATTGAATCCTCAAAAAATATTGCAAATTAAATGAATTACTATATAAATTCAGCA
AGTTAAATTGTGATTGATGAAGCATACAATAAATAAAAAATAGAAAAAAATCCTGTATCT
GCTTAGTTTATTTTGTAAGATAATCAAACTGCGACATCGTAAACTGACTCAAAAAAAGAT
ATAGAAAATCCAACTTCATAAAACAATTATAATTTAACTTTAGAAGGTGAATAAAATTAA
AGCGATAACCCTCCATCTGAAAGAAAAAAAATGCATGCAGACTTCTCTTCAGATAAATCC
TAAAAAGGTGAGCAAGATAAAACTTTCGACTCAGAAAATAGAGATGAAATGAGTATAAAA
TAAACAACTTAGTTCGAAAAGAAGGCAGAAACTTTATCAAATACTTACGATATGTCTTAG
TTGTTATGCTAAACTCCTTTATAATAGCATGGATAGCATATTAGATTAATGAGTGGAGGC
AACATGGAACATCTTACATTAAATAACTCAATATAATCTACTTTCCCATTTGAATAAATT
CAAAGTAATCAAACAACAAGTTATAATAATTACAGTAATTTTACAACTTCAAACAACTTA
CAAAGTGCTAACAATCACTAATCTAAAAATTAAGAAGTTGGTTTAAATTTATAAAATTCT
TTTGATAATGGTGAGCAGAATATTTAAATTTAAGTAAAAAGCTCTTAAATTACCAGACAA
TCTCAAGAAAAAAGAGAATAATAAAATCCAGAATTAGAATTAGAGAAGAAGAGTTCTAAA
GAGATTGGAAGATCATAAGATTCAAATTTGAACACACCTCAAAAGTGTTCAGAAAATCTA
TAATAATTATTGAATGATAATTAATAATCTAAATATAATACTCCTTAAACTATTGTATCA
GCTTAACCTAATGAGTTAGAAAACCAAAATATTTATGAAGACCAAGAGGTCTAATATGTT
TAAACTGCTACTCATAATCAAGAAAGAGAATTGTAAGAATATGATAAGTAGAACTTCACT
AATCCAGAGTTATTAAATTAAAGCAAATAATTATAAGAATCATAAAATAGAGATCTATAA
GTTTAAGCTGCTCATCATAACAAAGAAAAAGAGTTGTAAGAATATAATAATTAAAACATT
GCTAATATAGAGTAGCTTAATAAAAGCAAATAATTATAAGAATCATAAAAAGGTGATTAA
AATTAATAAGAAAATAGCATGCTTTAGGGATAAATAGGCGAAAATGAAAATGAGAAATAA
AAAAATATTTAAAAGAACATTAATCATGTTAGATTTAATAACCTTGTAAAGTAGATGTAA
GAAAATTCACCATGCCATAACTTAGGATATTATCATTATGAAACAATAAATATTGATGGA
AAAATCTTAAAAGATGTTTATTAGCAAACAGATAACATAGAAAAGAAAGAGATATCTGTG
TAAACAATCGAATAGTCTAAAAGAAATTCTATTTTTGATGAATGCACAAAACTATTTTCT
CCTAAAATGAAATTTATTGAACCCGAGTTTAAAGATAATGAATGCATGATGCTTAATATG
TCAAATAATTCTTCTTAATATGATCATAAAGATTCAATAAAAGAATAGCATGAAGGTGGT
TTTAATTATGATTAAAACTAGTAAAAAAATTTAAGAAAATCAGATTTCTTCAAATAGTAA
CCTAATTAGTAATAGCAACAATAAACTTCTTCAAACGGAAATCACGAAACAGGTATAATT
AATTCTTCATTGTATAACTCACAAAAGTTGGCTAGCGATAATGAAGAAGTCATTAAAAGG
TAATATTAAATTTATGATAAGATATTTGATGCTGGAGAACTCCCTGTTGTAGACTGCACA
GAGTAAGATAACATTTTTAAAGAGTGGTATTAGTCTGATCAAAGTAATTTTAAAAACAGA
AGATACTCTAACTAAATTAGTGACTCTGAGAAAAAAAATATACAACAATAAATAGATAAC
ATAGTTAATAAGAGAGCTTATAAAAATTAATAAGCCTTGATGAACCAACAAAAAAATTCT
CAGAGCAATTAACCTTAAATTGGTAAAAATAAGAGCAAATAGTAAACAAAAGTCCCCAAT
AAATAAAATCAAAAGTCTATAAAATTCAACAATAAAATAGAGACAAGAAACATACCAAAA
AATTCTAAACAGAAAAACTCAGCTATTCCAGGAAATAACACAGAAAGAGTTTTTGAGAGA
TTATACCCAAAGCAAGTAAAATAGTAACAAGAATAAATTTTTGAAATAAAGAAAGATACC
TCAAAGAGTAAAAGTAAAGGAAGAGCAACTTCATAATTTAAAACTCAAGAAGAAATGGAT
TTCATAAAAATTAATAAGTAAAAAGTACCATATATGATGAGAAAAAAAGTGGAGGACAAG
TTCTAACTATTTAAAAAGGCAGTAGAAGTTAATTTAGAAAACATGATTTAAGATTAGAAA
TCTCATTAGATAAAGAGTATAGTTTTAGATGATGAAATCAAAGACTAAGACAATCTATAA
GAGATATATTAAAGAAGTCTTTCCAACAGAACTTAAAAAAATTTAGTTTCTTACGACTCT
TAAACTATGACCAATCTAGCAAGGTATAATCCTTCATATAATCCATGA


>TTHERM_00492370(protein)
MNLQAQQKTRKQSKGQILEIFEQIKPTHYIQDTANGVSTKSFTKQIRYQSQNPKMSNQKE
LTDFQRTELEKQKRNQEYLFHIGNHARTVSDILKFRYDQYKQTLGQQEQQSEEQQRMQYQ
NQQSIWQNSTTMIQQYQQYHQAQESNIKRSNTLSNLQSQKSGVKICNSASKQSEKNQNTQ
KLLYKPAQIQSQKAISSILGSAESNISPIKKSYNEDLATAGDTRDNFASLSGGSLKSNPN
NFSFQDRKYVSEKDYLSIQRNLFDSIDTQKNSSIQNQQCSSIVQSKKESDEIDFNKQSKL
EKQNNQTFNKEDRLLQSPASLHLNQKSQSQDYLAQKNPTQQQQMSPHLIQPSHLLFVDSQ
QNQNQINYPNQFISSISQTSGQQNQTQEQFKIDQFKNNQINNNQKFLNQINYSQYNSIPS
LDISQAQNKEGIINTDIKPIQKYQENLQSTSTIETNQLAQANKITESKFTNFAKSNDQSQ
MQSASDIYSFNQPYSTSQISSQILSTERQFKIKLTKITKDSQISEEYQINKSPSSFTQLE
NKQDLLIKFAEARKQEHLNNLYDDAQSDFSKTPQTNKSEVIKRFKASQIFDQNQSQANSK
PSQNKSSQIYYNNNSQYDFANSVKEINNEHKYTNLMSSAQQQNLSHQIPTLSGMGRINNF
IRKSQEGNKQSNYFTQISDSQIQNAGNVTKQSASFNPNYHLLESYTNSLVKQNNNETLNP
LNTQNQIKNLIDYNSPKQNIQNIQASGLYNQSSFQQETKSSLSMIKNIFESTLNNQENPS
NQNLISSSPKNLELNIILSKYQSNKEKQNLRQSSQFQQQTPSIQLETKNSFAKSIDQHFS
QQNTRLSNTLAELNQSSQVKNSLTVLENQKIQQIMDDIQAKISLKKSQSLEQSGIAMQSS
SNKFSQYFEKKTSNSQVIDNGMNEQNGLIVSFANNSLVGQSTIESSKNIANQMNYYINSA
SQIVIDEAYNKQKIEKNPVSAQFILQDNQTATSQTDSKKDIENPTSQNNYNLTLEGEQNQ
SDNPPSERKKMHADFSSDKSQKGEQDKTFDSENRDEMSIKQTTQFEKKAETLSNTYDMSQ
LLCQTPLQQHGQHIRLMSGGNMEHLTLNNSIQSTFPFEQIQSNQTTSYNNYSNFTTSNNL
QSANNHQSKNQEVGLNLQNSFDNGEQNIQIQVKSSQITRQSQEKREQQNPELELEKKSSK
EIGRSQDSNLNTPQKCSENLQQLLNDNQQSKYNTPQTIVSAQPNELENQNIYEDQEVQYV
QTATHNQERELQEYDKQNFTNPELLNQSKQLQESQNRDLQVQAAHHNKEKELQEYNNQNI
ANIEQLNKSKQLQESQKGDQNQQENSMLQGQIGENENEKQKNIQKNINHVRFNNLVKQMQ
ENSPCHNLGYYHYETINIDGKILKDVYQQTDNIEKKEISVQTIEQSKRNSIFDECTKLFS
PKMKFIEPEFKDNECMMLNMSNNSSQYDHKDSIKEQHEGGFNYDQNQQKNLRKSDFFKQQ
PNQQQQQQTSSNGNHETGIINSSLYNSQKLASDNEEVIKRQYQIYDKIFDAGELPVVDCT
EQDNIFKEWYQSDQSNFKNRRYSNQISDSEKKNIQQQIDNIVNKRAYKNQQALMNQQKNS
QSNQPQIGKNKSKQQTKVPNKQNQKSIKFNNKIETRNIPKNSKQKNSAIPGNNTERVFER
LYPKQVKQQQEQIFEIKKDTSKSKSKGRATSQFKTQEEMDFIKINKQKVPYMMRKKVEDK
FQLFKKAVEVNLENMIQDQKSHQIKSIVLDDEIKDQDNLQEIYQRSLSNRTQKNLVSYDS
QTMTNLARYNPSYNP


>TTHERM_00492370(gene)
ATGAATCTCTAAGCATAGTAAAAAACAAGAAAATAGTCGAAAGGCTAAATTTTAGAGATA
TTTGAGTAAATAAAGCCTACTCATTATATTTAAGACACTGCAAATGGTGTTTCAACCAAA
TCATTTACAAAGTAAATAAGATACCAAAGTCAGAATCCTAAAATGAGCAATTAAAAAGAA
GTAAAATTAATTATTCATATGCTTTATATAAAATAAATTTATTTTTTTAAAAAAGCTTAC
TGACTTTCAAAGGACAGAGCTAGAAAAGCAAGTAATTTTCCAACTTTTTAAAGGCATTTT
ATTTCCTTTTAAATTTTATGTTTATGCCTAATAATTCAAATAAGCTCGAAAGCATTTAAT
AAACATGTAAAAAAATGTAATTAAGTTAACTTGTTTTTATATATTATTAGAAAAGGAATC
AAGAGTATCTCTTTCATATTGGAAATCATGCAAGAACTGTCAGTGATATTTTGAAGTTTA
GATATGATTAATATAAACAAACTTTAGGGTAACAAGAGTAGTAGTCAGAAGAGTAATAAA
GAATGTAGTATTAAAATCAATAATCTATATGGTAAAACTCTACAACTATGATATAATAAT
ACTAATAATACCACTAAGCATAAGAATCAAATATCAAGAGATCTAATACACTCAGCAATT
TATAGAGTTAAAAATCAGGAGTTAAAATTTGTAATTCTGCTAGCAAATAAAGCGAAAAAA
ATTAAAATACATAAAAGCTTTTATATAAGCCAGCTCAAATACAGTCTTAAAAAGCTATCT
CTTCTATTTTAGGAAGCGCTGAATCAAATATTTCACCAATAAAAAAATCTTATAATGAAG
ATTTGGCAACTGCAGGAGACACAAGAGATAACTTTGCATCTTTAAGTGGAGGATCTTTAA
AATCAAACCCTAATAATTTTTCTTTCTAAGATAGAAAATATGTTAGTGAAAAAGACTATT
TATCCATTTAAAGGAACCTTTTTGATTCTATAGACACACAAAAGAATAGTTCTATTTAAA
ATTAACAATGTTCTTCAATTGTTCAATCAAAAAAAGAATCAGACGAAATAGATTTCAATA
AATAATCTAAATTAGAAAAGTAAAATAATCAAACTTTTAACAAAGAAGATAGATTATTAT
AATCTCCAGCATCTTTACATTTAAATTAGAAATCATAATCATAAGATTACTTGGCATAAA
AAAATCCTACATAATAACAATAAATGAGCCCACATCTTATTTAACCTAGCCATTTGCTCT
TCGTCGACAGTCAATAAAATTAAAATTAGATAAATTATCCAAACCAATTTATATCAAGCA
TTTCATAAACCTCTGGTTAATAAAATTAAACATAGGAATAATTCAAAATTGATTAATTCA
AAAACAATCAAATAAATAATAATTAAAAGTTTTTGAACTAAATAAATTATTCTTAATATA
ATTCAATTCCTTCGCTAGATATAAGCTAAGCTTAAAATAAGGAAGGTATCATAAATACAG
ATATTAAGCCTATTCAAAAATATTAAGAAAATCTGTAGTCAACCTCAACAATAGAAACTA
ATTAATTAGCTTAAGCAAATAAAATTACTGAATCAAAATTTACAAATTTTGCTAAAAGTA
ATGATTAGTCATAAATGCAATCAGCCTCTGATATATATTCATTTAATTAGCCATATAGTA
CTAGCTAGATAAGTTCCCAAATTCTCTCTACTGAAAGGTAATTCAAAATAAAGCTGACTA
AAATTACAAAGGATTCTTAGATTTCGGAAGAATATCAGATAAATAAATCTCCTTCATCTT
TTACTTAATTAGAAAATAAGTAAGACCTTTTAATCAAATTCGCTGAAGCAAGAAAATAAG
AGCATTTAAATAATTTATATGATGATGCTTAATCAGATTTTTCTAAAACTCCTTAGACAA
ACAAATCTGAGGTAATTAAAAGGTTTAAAGCTTCTCAAATTTTTGATTAAAATTAATCAT
AAGCAAATAGTAAGCCAAGTTAGAATAAGTCTTCATAAATATATTACAATAATAATAGCT
AGTATGATTTTGCAAATAGTGTCAAAGAAATAAATAATGAACACAAGTACACAAATTTAA
TGTCATCCGCTTAACAATAAAACTTATCACACTAAATACCCACCTTAAGTGGAATGGGAA
GAATTAACAATTTTATTAGAAAATCTTAAGAAGGAAACAAATAAAGCAACTATTTTACTC
AAATTTCAGATTCATAAATTTAGAATGCCGGAAATGTTACAAAGTAATCAGCATCTTTTA
ATCCAAACTATCACTTACTAGAAAGCTATACTAATAGTTTAGTTAAACAAAATAATAATG
AAACTTTAAACCCTCTTAATACTTAAAATTAAATAAAGAATCTGATCGATTATAATAGCC
CCAAATAGAATATTTAAAATATCTAAGCATCTGGACTTTATAATCAGAGTTCATTCTAAT
AAGAAACAAAATCTAGTCTTAGTATGATAAAAAATATTTTTGAGAGCACCCTAAACAACT
AAGAAAATCCATCAAATTAGAATTTAATTTCTTCATCTCCCAAGAATTTAGAATTAAATA
TTATTCTGAGTAAGTATTAATCCAACAAAGAAAAATAAAATTTAAGATAAAGTTCATAAT
TCTAGTAATAAACACCTTCTATATAGTTGGAAACAAAGAACTCTTTCGCCAAAAGCATTG
ACTAACACTTTTCATAACAGAATACACGTTTATCAAATACATTAGCTGAATTAAACTAAA
GTAGTTAGGTGAAAAATAGCCTCACAGTTCTTGAAAACTAAAAAATTTAGCAAATTATGG
ATGATATTTAAGCCAAAATATCTTTAAAAAAATCATAATCTTTAGAATAATCTGGTATCG
CTATGTAATCATCTTCAAATAAATTTTCATAATACTTCGAAAAGAAAACTTCAAACTCAT
AAGTTATTGATAACGGCATGAATGAGTAAAATGGTTTAATAGTTAGTTTTGCAAATAATT
CTCTAGTAGGTTAATCTACAATTGAATCCTCAAAAAATATTGCAAATTAAATGAATTACT
ATATAAATTCAGCAAGTTAAATTGTGATTGATGAAGCATACAATAAATAAAAAATAGAAA
AAAATCCTGTATCTGCTTAGTTTATTTTGTAAGATAATCAAACTGCGACATCGTAAACTG
ACTCAAAAAAAGATATAGAAAATCCAACTTCATAAAACAATTATAATTTAACTTTAGAAG
GTGAATAAAATTAAAGCGATAACCCTCCATCTGAAAGAAAAAAAATGCATGCAGACTTCT
CTTCAGATAAATCCTAAAAAGGTGAGCAAGATAAAACTTTCGACTCAGAAAATAGAGATG
AAATGAGTATAAAATAAACAACTTAGTTCGAAAAGAAGGCAGAAACTTTATCAAATACTT
ACGATATGTCTTAGTTGTTATGCTAAACTCCTTTATAATAGCATGGATAGCATATTAGAT
TAATGAGTGGAGGCAACATGGAACATCTTACATTAAATAACTCAATATAATCTACTTTCC
CATTTGAATAAATTCAAAGTAATCAAACAACAAGTTATAATAATTACAGTAATTTTACAA
CTTCAAACAACTTACAAAGTGCTAACAATCACTAATCTAAAAATTAAGAAGTTGGTTTAA
ATTTATAAAATTCTTTTGATAATGGTGAGCAGAATATTTAAATTTAAGTAAAAAGCTCTT
AAATTACCAGACAATCTCAAGAAAAAAGAGAATAATAAAATCCAGAATTAGAATTAGAGA
AGAAGAGTTCTAAAGAGATTGGAAGATCATAAGATTCAAATTTGAACACACCTCAAAAGT
GTTCAGAAAATCTATAATAATTATTGAATGATAATTAATAATCTAAATATAATACTCCTT
AAACTATTGTATCAGCTTAACCTAATGAGTTAGAAAACCAAAATATTTATGAAGACCAAG
AGGTCTAATATGTTTAAACTGCTACTCATAATCAAGAAAGAGAATTGTAAGAATATGATA
AGTAGAACTTCACTAATCCAGAGTTATTAAATTAAAGCAAATAATTATAAGAATCATAAA
ATAGAGATCTATAAGTTTAAGCTGCTCATCATAACAAAGAAAAAGAGTTGTAAGAATATA
ATAATTAAAACATTGCTAATATAGAGTAGCTTAATAAAAGCAAATAATTATAAGAATCAT
AAAAAGGTGATTAAAATTAATAAGAAAATAGCATGCTTTAGGGATAAATAGGCGAAAATG
AAAATGAGAAATAAAAAAATATTTAAAAGAACATTAATCATGTTAGATTTAATAACCTTG
TAAAGTAGATGTAAGAAAATTCACCATGCCATAACTTAGGATATTATCATTATGAAACAA
TAAATATTGATGGAAAAATCTTAAAAGATGTTTATTAGCAAACAGATAACATAGAAAAGA
AAGAGATATCTGTGTAAACAATCGAATAGTCTAAAAGAAATTCTATTTTTGATGAATGCA
CAAAACTATTTTCTCCTAAAATGAAATTTATTGAACCCGAGTTTAAAGATAATGAATGCA
TGATGCTTAATATGTCAAATAATTCTTCTTAATATGATCATAAAGATTCAATAAAAGAAT
AGCATGAAGGTGGTTTTAATTATGATTAAAACTAGTAAAAAAATTTAAGAAAATCAGATT
TCTTCAAATAGTAACCTAATTAGTAATAGCAACAATAAACTTCTTCAAACGGAAATCACG
AAACAGGTATAATTAATTCTTCATTGTATAACTCACAAAAGTTGGCTAGCGATAATGAAG
AAGTCATTAAAAGGTAATATTAAATTTATGATAAGATATTTGATGCTGGAGAACTCCCTG
TTGTAGACTGCACAGAGTAAGATAACATTTTTAAAGAGTGGTATTAGTCTGATCAAAGTA
ATTTTAAAAACAGAAGATACTCTAACTAAATTAGTGACTCTGAGAAAAAAAATATACAAC
AATAAATAGATAACATAGTTAATAAGAGAGCTTATAAAAATTAATAAGCCTTGATGAACC
AACAAAAAAATTCTCAGAGCAATTAACCTTAAATTGGTAAAAATAAGAGCAAATAGTAAA
CAAAAGTCCCCAATAAATAAAATCAAAAGTCTATAAAATTCAACAATAAAATAGAGACAA
GAAACATACCAAAAAATTCTAAACAGAAAAACTCAGCTATTCCAGGAAATAACACAGAAA
GAGTTTTTGAGAGATTATACCCAAAGCAAGTAAAATAGTAACAAGAATAAATTTTTGGTA
AATTTTTTAATTAATTTCTTTGAGGTTTTGTATTTAAAAAAACATTTTTCTTCAACTATC
ATGTAAAAAAACTCATAATTTAACAAAATTTTTAAAATTAATATGTTGACTTGCTTTTTA
AAAATATTTATCGATTATTAAATTTAAAAATAGAAATAAAGAAAGATACCTCAAAGAGTA
AAAGTAAAGGAAGAGCAACTTCATAATTTAAAACTCAAGAAGAAATGGATTTCATAAAAA
TTAATAAGTAAAAAGTACCATATATGATGAGAAAAAAAGTGGAGGACAAGTTCTAACTAT
TTAAAAAGGCAGTAGAAGTTAATTTAGAAAACATGATTTAAGATTAGAAATCTCATTAGA
TAAAGAGTATAGTTTTAGATGATGAAATCAAAGACTAAGACAATCTATAAGAGATATATT
AAAGAAGTCTTTCCAACAGAACTTAAAAAAATTTAGTTTCTTACGACTCTTAAACTATGA
CCAATCTAGCAAGGTATAATCCTTCATATAATCCATGA