Identifiers and Description

Gene Model Identifier

TTHERM_00575520

Standard Name

MPK4 (Mitogen-activated Protein Kinase )

Aliases

PreTt28942 | 77.m00154 | 3812.m02636 | XP_001009345

Description

Putative ERK7 subfamily mitogen-activated protein (MAP) kinase

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 11.6%

TetraMine Data

TTHERM_00575520

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Stentor CoeruleusSteCoe_43170
Tetrahymena borealisEI9_04020.19.997093137033517e-262protein kinase domain-containi
ng protein (769 aa)
OxytrichaContig194.1.g746.001748851346514e-171Protein kinase domain
DictyBaseDDB_G02839035.001736064328732e-162erkB on chromosome: 4 position
1385123 to 1386548
WormBaseWBGene000154781.0004771100126706e-129Putative serine/threonine-prot
ein kinase C05D10.2 status:C
onfirmed UniProt:Q11179 pr
otein_id:CCD63173.1
SGDYBL016W2.9993408039826107e-81FUS3 Mitogen-activated serine/
threonine protein kinase invol
ved in mating; phosphoactivate
d by Ste7p; substrates include
Ste12p, Far1p, Bni1p, Sst2p;
inhibits invasive growth durin
g mating by phosphorylating Te
c1p, promoting its degradation

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:25286252: Yıldız MT, Arslanyolu M (2014) In silico identification and characterization of the MAPK family members of unicellular model eukaryote Tetrahymena thermophila. European journal of protistology 50(5):538-50
  2. Ref:16933976: Eisen JA, Coyne RS, Wu M, Wu D, Thiagarajan M, Wortman JR, Badger JH, Ren Q, Amedeo P, Jones KM, Tallon LJ, Delcher AL, Salzberg SL, Silva JC, Haas BJ, Majoros WH, Farzad M, Carlton JM, Smith RK, Garg J, Pearlman RE, Karrer KM, Sun L, Manning G, Elde NC, Turkewitz AP, Asai DJ, Wilkes DE, Wang Y, Cai H, Collins K, Stewart BA, Lee SR, Wilamowska K, Weinberg Z, Ruzzo WL, Wloga D, Gaertig J, Frankel J, Tsao CC, Gorovsky MA, Keeling PJ, Waller RF, Patron NJ, Cherry JM, Stover NA,
  3. Ref:17821280: Harrison JA, Fowler EH (1945) AN ANTIGEN-ANTIBODY REACTION WITH TETRAHYMENA WHICH RESULTS IN DYSTOMY. Science (New York, N.Y.) 102(2638):65-6

Sequences

>TTHERM_00575520(coding)
ATGAGCAGCAACGAAGAAATTGAACCACATATTTTAAGAAAGTTTGAAATCATTCAAAAA
TTGGGTAAAGGAGCTTATGGTATTGTTTGGAAAGCATTTTGCAAGAAGTCAAAGCAAATA
GTTGCTTTAAAAAAAGTATTCGATGCATTCCATAACGCTACTGATGCTCAAAGAACATTC
CGTGAAGTAATGTTCTTGCAAGAGCTTAATGGACACGAGAATATCATTAGGCTAATCAAC
ATCATCAAAGCAGAAAATAATAAAGATTTGTACATGGTTTTTGACTTCATGGAAACTGAT
TTACATGCTGTTATTAGAGCAAATATATTAGAAGAAATACACAAATAGTATGTTGTCTAT
TAAATTCTTAAAGCTATGAAATACATTCATTCAGGTGAACTGATCCATCGTGACTTGAAG
CCATCTAATATCCTCCTAAATAGCGAATGCTTGGTTAAATTAGCTGATTTTGGACTTGCC
CGTTCCGTTGCAGTTACCGATGATGATGACAATCCTGTCAGAACAGAGTATGTTGCTACT
CGTTGGTATCGTGCCCCTGAAATCTTATTAGGTAGTACTAAATATGCTAAGGCTGTTGAT
ATGTGGAGCATCGGCTGCATAGTAGGAGAACTTATAACTAACAGAGCTATCTTCCCAGGT
AATTCCACTCTCAATCAAATTGAAAAAGTTTTAGAATTGACTGGTAAACCCACTTAGGAA
GATATTGAGTCGTTAGAATCCCAACTAGCATGGAATATCATAAGTTCAATTAATGTTTAA
AAGAAAAAAACATTCCATTAAATGTTCCCTGGTGCAAGCGAAGAAGCAATTGATCTCATC
AAGAAACTCCTCTGTTTCAACCCTAAAAATCGTCTTACAGTTGAATAAGCCTTAGAGCAT
CCTTACGTTAAAGACTTCCACTGTCCTGAAGAAGAAATTGTTTGCGGAAGAGTCATCCCC
ATCAGCATGAACGACAATAAAAAATTCTCAATCAAAGAATACAGAGAAGCACTTTATAAT
TAAATTTACTAAGAAAAGAGAATCAAACGCTAATAAAACAGAGACATTTACCTTAAGCAA
TAATAATAAATTACTACAACTGGAAATGGGTAGGTTTCTTAAGCTGGATAATCTTCCCAA
CCAGTTTCATCCCAACAAATACCTTCCTCTTCTTAATCTACTTAATCATCTGTGACTCAA
TAGTAATAGCAATAATAGCAGTAAGAAAAAAGCAAGAACCAATATCAAAGCAGCTCCTCT
CAATAGTAGTAAGCTTAACAGTACCAATAGTAGCAATCCCTTTAATAACAATAGGTACCT
TAGCGCCAATCGTCTCAATCCTCTTAGCCTTAATCTCAGTAAAGCATATAATAAAATTAA
CAGAAGTACTAATAGTCATAGTAATAATAATAGCGTTACTTTGATCAGGAAAAAGAATAG
TACAAGCCAAATGCTCAACAATAATACCTTCAATAGTAACAACAACTCCAATAATAGCAA
GCTTTACAACAATAATAAATGCAAAAATCTTATTACAACTCACAAAACTTTAATAGTAGC
TAAGTTTAAGTCTAATAAGGTAACTCATAATCAACATCTCAAGGAAATAATTACAGTGGC
TACAAATCAGGAAGCTAGGCCAGCACCACTAATGCATCATCTTCAGCTTAATATGCTGGC
TATGATGACAAAAAAGTACTAATGAACTCTTCTAATTAAATTTAAAATAAAAATTCCTCT
TAAGTCTACACTCAAAGCTAAGGAGCAAACTAAGCTAGCTCTTCAAACACATAGCAATAA
TACTTACCTAGTTCTTCAAATACTATCTATGGATAGGGAGTAACAAATTCTATTGCTAAC
AGCAATAATCTTTACAATTAAGCTTAATTGAATGGCTCCAAGTAGCAATCTTCATCACTA
GGTCACACATAAAATAAGTATTCATCCACTTAAGCTTATCAATAAGCACAGCCCTCTAAA
TATATGAATTAGACTTAAAATGCTTAGAAATATGTCAATAATAACAACAATAGTAACGGG
TAGTTAGGAGGAAGCTAGAATAATATTGGTGGAAGTTAAACAAACTCTTAAAATCATTAC
TAAGCTGCATAGTAATATCTCTAACAACACATGTAATAGCAATAGTAATAACAACAAGTT
TAATAACCATAGACTAAATATGGAGTTACTTACCACCATGGACATTCACAAAGTTCTGGA
TCAAGTAACACCTTTGCCTAGTATTAGCAACATTACCAATAATAGCAACAAAGAACAACA
GGAGTAACTGCTAATCACTAGAGATAGCCTTCAAATAATGCTCAAAAAGTTCGCAAAGTA
GAATAAAAAATGTGA


>TTHERM_00575520(protein)
MSSNEEIEPHILRKFEIIQKLGKGAYGIVWKAFCKKSKQIVALKKVFDAFHNATDAQRTF
REVMFLQELNGHENIIRLINIIKAENNKDLYMVFDFMETDLHAVIRANILEEIHKQYVVY
QILKAMKYIHSGELIHRDLKPSNILLNSECLVKLADFGLARSVAVTDDDDNPVRTEYVAT
RWYRAPEILLGSTKYAKAVDMWSIGCIVGELITNRAIFPGNSTLNQIEKVLELTGKPTQE
DIESLESQLAWNIISSINVQKKKTFHQMFPGASEEAIDLIKKLLCFNPKNRLTVEQALEH
PYVKDFHCPEEEIVCGRVIPISMNDNKKFSIKEYREALYNQIYQEKRIKRQQNRDIYLKQ
QQQITTTGNGQVSQAGQSSQPVSSQQIPSSSQSTQSSVTQQQQQQQQQEKSKNQYQSSSS
QQQQAQQYQQQQSLQQQQVPQRQSSQSSQPQSQQSIQQNQQKYQQSQQQQQRYFDQEKEQ
YKPNAQQQYLQQQQQLQQQQALQQQQMQKSYYNSQNFNSSQVQVQQGNSQSTSQGNNYSG
YKSGSQASTTNASSSAQYAGYDDKKVLMNSSNQIQNKNSSQVYTQSQGANQASSSNTQQQ
YLPSSSNTIYGQGVTNSIANSNNLYNQAQLNGSKQQSSSLGHTQNKYSSTQAYQQAQPSK
YMNQTQNAQKYVNNNNNSNGQLGGSQNNIGGSQTNSQNHYQAAQQYLQQHMQQQQQQQQV
QQPQTKYGVTYHHGHSQSSGSSNTFAQYQQHYQQQQQRTTGVTANHQRQPSNNAQKVRKV
EQKM


>TTHERM_00575520(gene)
ATGAGCAGCAACGAAGAAATTGAACCACATATTTTAAGAAAGTTTGAAATCATTCAAAAA
TTGGGTAAAGGAGCTTATGGTATTGTTTGGAAAGCATTTTGCAAGAAGTCAAAGCAAATA
GTTGCTTTAAAAAAAGTATTCGATGCATTCCATAACGCTACTGATGCTCAAAGAACATTC
CGTGAAGTAATGTTCTTGCAAGAGCTTAATGGACACGAGAATATCATTAGGCTAATCAAC
ATCATCAAAGCAGAAAATAATAAAGATTTGTACATGGTTTTTGACTTCATGGAAACTGAT
TTACATGCTGTTATTAGAGCAAATATATTAGAAGAAATACACAAATAGTATGTTGTCTAT
TAAATTCTTAAAGCTATGAAATACATTCATTCAGGTGAACTGATCCATCGTGACTTGAAG
CCATCTAATATCCTCCTAAATAGCGAATGCTTGGTTAAATTAGCTGATTTTGGACTTGCC
CGTTCCGTTGCAGTTACCGATGATGATGACAATCCTGTCAGAACAGAGTATGTTGCTACT
CGTTGGTATCGTGCCCCTGAAATCTTATTAGGTAGTACTAAATATGCTAAGGCTGTTGAT
ATGTGGAGCATCGGCTGCATAGTAGGAGAACTTATAACTAACAGAGCTATCTTCCCAGGT
AATTCCACTCTCAATCAAATTGAAAAAGTTTTAGAATTGACTGGTAAACCCACTTAGGAA
GATATTGAGTCGTTAGAATCCCAACTAGCATGGAATATCATAAGTTCAATTAATGTTTAA
AAGAAAAAAACATTCCATTAAATGTTCCCTGGTGCAAGCGAAGAAGCAATTGATCTCATC
AAGAAACTCCTCTGTTTCAACCCTAAAAATCGTCTTACAGTTGAATAAGCCTTAGAGCAT
CCTTACGTTAAAGACTTCCACTGTCCTGAAGAAGAAATTGTTTGCGGAAGAGTCATCCCC
ATCAGCATGAACGACAATAAAAAATTCTCAATCAAAGAATACAGAGAAGCACTTTATAAT
TAAATTTACTAAGAAAAGAGAATCAAACGCTAATAAAACAGAGACATTTACCTTAAGCAA
TAATAATAAATTACTACAACTGGAAATGGGTAGGTTTCTTAAGCTGGATAATCTTCCCAA
CCAGTTTCATCCCAACAAATACCTTCCTCTTCTTAATCTACTTAATCATCTGTGACTCAA
TAGTAATAGCAATAATAGCAGTAAGAAAAAAGCAAGAACCAATATCAAAGCAGCTCCTCT
CAATAGTAGTAAGCTTAACAGTACCAATAGTAGCAATCCCTTTAATAACAATAGGTACCT
TAGCGCCAATCGTCTCAATCCTCTTAGCCTTAATCTCAGTAAAGCATATAATAAAATTAA
CAGAAGTACTAATAGTCATAGTAATAATAATAGCGTTACTTTGATCAGGAAAAAGAATAG
TACAAGCCAAATGCTCAACAATAATACCTTCAATAGTAACAACAACTCCAATAATAGCAA
GCTTTACAACAATAATAAATGCAAAAATCTTATTACAACTCACAAAACTTTAATAGTAGC
TAAGTTTAAGTCTAATAAGGTAACTCATAATCAACATCTCAAGGAAATAATTACAGTGGC
TACAAATCAGGAAGCTAGGCCAGCACCACTAATGCATCATCTTCAGCTTAATATGCTGGC
TATGATGACAAAAAAGTACTAATGAACTCTTCTAATTAAATTTAAAATAAAAATTCCTCT
TAAGTCTACACTCAAAGCTAAGGAGCAAACTAAGCTAGCTCTTCAAACACATAGCAATAA
TACTTACCTAGTTCTTCAAATACTATCTATGGATAGGGAGTAACAAATTCTATTGCTAAC
AGCAATAATCTTTACAATTAAGCTTAATTGAATGGCTCCAAGTAGCAATCTTCATCACTA
GGTCACACATAAAATAAGTATTCATCCACTTAAGCTTATCAATAAGCACAGCCCTCTAAA
TATATGAATTAGACTTAAAATGCTTAGAAATATGTCAATAATAACAACAATAGTAACGGG
TAGTTAGGAGGAAGCTAGAATAATATTGGTGGAAGTTAAACAAACTCTTAAAATCATTAC
TAAGCTGCATAGTAATATCTCTAACAACACATGTAATAGCAATAGTAATAACAACAAGTT
TAATAACCATAGACTAAATATGGAGTTACTTACCACCATGGACATTCACAAAGTTCTGGA
TCAAGTAACACCTTTGCCTAGTATTAGCAACATTACCAATAATAGCAACAAAGAACAACA
GGAGTAACTGCTAATCACTAGAGATAGCCTTCAAATAATGCTCAAAAAGTTCGCAAAGTA
GAATAAAAAATGTGA