Identifiers and Description

Gene Model Identifier

TTHERM_00760190

Standard Name

MPK2 (Mitogen-activated Protein Kinase )

Aliases

PreTt18504 | 125.m00068 | 3672.m00001 | XP_001031635.2

Description

Putative ERK1/2 subfamily mitogen-activated protein (MAP) kinase

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( PF00069 ) protein kinase domain
  • ( PF07714 ) protein tyrosine kinase
  • ( PF06293 ) Lipopolysaccharide kinase (Kdo/WaaP) family

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00760190

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_18964.19.997093137033517e-262protein kinase domain-containi
ng protein (427 aa)
OxytrichaContig21734.0.g776.999793971601071e-169Protein kinase domain
DictyBaseDDB_G02863538.998537725811687e-130erkA on chromosome: 4 position
4355028 to 4356796
SGDYLR113W5.002059218654967e-104HOG1 Mitogen-activated protein
kinase involved in osmoregula
tion; acts via three independe
nt osmosensors; mitophagy-spec
ific regulator; mediates the r
ecruitment and activation of R
NA Pol II at Hot1p-dependent p
romoters; localization regulat
ed by Ptp2p and Ptp3p
WormBaseWBGene000034012.000724368835138e-100locus:mpk-1 Mitogen-activate
d protein kinase mpk-1 statu
s:Confirmed UniProt:P39745
protein_id:CAA87057.1
Stentor CoeruleusSteCoe_279264.020060215743355e-74

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:24858074: Arslanyolu M, Yıldız MT (2014) Cloning, expression and characterization of a gene encoding mitogen activated protein kinase 2 (MPK2) from Tetrahymena thermophila. Gene 546(1):40-9
  2. Ref:25286252: Yıldız MT, Arslanyolu M (2014) In silico identification and characterization of the MAPK family members of unicellular model eukaryote Tetrahymena thermophila. European journal of protistology 50(5):538-50
  3. Ref:16933976: Eisen JA, Coyne RS, Wu M, Wu D, Thiagarajan M, Wortman JR, Badger JH, Ren Q, Amedeo P, Jones KM, Tallon LJ, Delcher AL, Salzberg SL, Silva JC, Haas BJ, Majoros WH, Farzad M, Carlton JM, Smith RK, Garg J, Pearlman RE, Karrer KM, Sun L, Manning G, Elde NC, Turkewitz AP, Asai DJ, Wilkes DE, Wang Y, Cai H, Collins K, Stewart BA, Lee SR, Wilamowska K, Weinberg Z, Ruzzo WL, Wloga D, Gaertig J, Frankel J, Tsao CC, Gorovsky MA, Keeling PJ, Waller RF, Patron NJ, Cherry JM, Stover NA,

Sequences

>TTHERM_00760190(coding)
ATGGAGCATTAGGTGCCTAAAGAAATTATAGAATACTACAAACCATATGAAAACAAGAAA
TCAAATATTAGAGTTTAAAATGTATTGAGTGCCTCTAAATTTGAAATGGACGATAATTAT
AGTATCATAGACTCAATTGGTCAGGGAGCTTATGGTATTGTTGTAGCAGCTAGAGACTTG
AATTGTTAGGACGAAGAGAATAATTTGGTAGCAATCAAAAAAATAGAAAAAGCATTTGAA
CATAAAATATTTACAAAAAGAACATTGAGAGAACTGCGTTTACTTAGATTGCTTAAGCAC
GAAAATATTATCGGCATCAATACATTATTATTACCTAGATCAAGAGAAAAATTTGAAGAT
ATATATGTAGTTTCTGAGTTGATGGAGACAGATTTAGCATCAATTATAAAAAGTGAACAA
CCACTTACTGATGAGCATTGTCAATTCTTCCTATACTAAATCCTTCGTGGTTTAAAATAT
ATACATTCAGCAAAGGTCGTTCATCGTGACTTAAAACCTAGAAATTTGCTTGTAAATTCT
AACTGTGATTTAAAAATTTGTGATTTTGGTTTAGCTAGAACAATTATTCCTGGGCTAAAG
TGTAGAGCTGGTATGCTAACAGATTATGTTGCAACCAGGTGGTATAGAGCCCCAGAACTT
CTTTTATCTTGGAGAGACTATGATGAAAAAGTTGATGTCTGGTCGGTAGGTTGTATTTTT
GCAGAACTATTGAGAAGAAAACCATTTTTACCAGGAATAGATACAAGAAATCAAATAGAG
CTTATTTTTGAGTATCTGGGTACTCCTAGTGAATAAGAAATAAATAATATTCCAAGAGAA
AAGTTTAGAAAAATGGTTAAAAACATGCCTAAGAGATAGCCAAAGCAGTTTGAAAAATTA
TTCAGCAAAGCCTCAAAAGAAGCAATTGATTTACTTAGAAAACTTTTGACTTTTGATTTC
ACAAAAAGAATTACCGTAGATGAAGCTTTAAGCCATCCTTATTTATCTGAATTGCATTTC
CCTGAAGATGAACCAACATGTGAGCCTGTTTCTAAGCTTGATTTTGAATTTGAAGAGCAT
AATCTTACTTTACAGTAATTAAAAGACCTCATATACGAAGAAATATTATATTATCACTAT
CCCTCATTTAAACAAGAATACGAAACTAAAAAAGCAAATGGTTAGTCTCTTATTTCTCAT
ATCATAAATAATGCTAATAGAAATGTGCCTGATCCCCACTCGAGCGATGATGATTAAAGT
GATGATGATGACGAAAATTGA


>TTHERM_00760190(protein)
MEHQVPKEIIEYYKPYENKKSNIRVQNVLSASKFEMDDNYSIIDSIGQGAYGIVVAARDL
NCQDEENNLVAIKKIEKAFEHKIFTKRTLRELRLLRLLKHENIIGINTLLLPRSREKFED
IYVVSELMETDLASIIKSEQPLTDEHCQFFLYQILRGLKYIHSAKVVHRDLKPRNLLVNS
NCDLKICDFGLARTIIPGLKCRAGMLTDYVATRWYRAPELLLSWRDYDEKVDVWSVGCIF
AELLRRKPFLPGIDTRNQIELIFEYLGTPSEQEINNIPREKFRKMVKNMPKRQPKQFEKL
FSKASKEAIDLLRKLLTFDFTKRITVDEALSHPYLSELHFPEDEPTCEPVSKLDFEFEEH
NLTLQQLKDLIYEEILYYHYPSFKQEYETKKANGQSLISHIINNANRNVPDPHSSDDDQS
DDDDEN


>TTHERM_00760190(gene)
ATGGAGCATTAGGTGCCTAAAGAAATTATAGAATACTACAAACCATATGAAAACAAGAAA
TCAAATATTAGAGTTTAAAATGTATTGAGTGCCTCTAAATTTGAAATGGACGATAATTAT
AGTATCATAGACTCAAGTAGGCATTATTATTTCATATTCCAAACACATGAGTTTTCTATC
AATTAGTTAATTCCCTAATTTCACAAAATCTTTTTTTAAGTCTGATTTTTTTAATGTGGA
ATAAAGTAGATTTTCATAAAATAGAAGCTAAACAAAAAGCTTGATGCAATCATTATTTTT
AATAACTTTCATATATAAATAATAATTAAAATATAGTTGGTCAGGGAGCTTATGGTATTG
TTGTAGCAGCTAGAGACTTGAATTGTTAGGACGAAGAGAATAATTTGGTAGCAATCAAAA
AAATAGAAAAAGCATTTGAACATAAAATATTTACAAAAAGAACATTGAGAGAACTGCGTT
TACTTAGATTGCTTAAGCACGAAAATGTAAAAATATTATGAAATTTGAAAACAAATCAGC
TCAATTTAGAGTTAATTAAAAAAATCAAAACATTAAGTTTTATAATTATTCGCGCAATAC
AGACATAGCCCGACTAAATTGAAAAAAAGATATTTGTTTATTCCAAATTAAATTTGTTAT
ATAATATTTTATTGTTAAATTATAGATTATCGGCATCAATACATTATTATTACCTAGATC
AAGAGAAAAATTTGAAGATATGTAAATAATGGCTTTTACTTTATCATTTCTTGCTTCAAT
TTATTTATAGGCAATAAAGCTATTTTGATTTTGTTTGTTTGTTAAGTTTTTGCTAATCAA
ACTTAAAGGAGAAATAAATAATAGCAAGCTGATTAACTAAAAAGCAATTAATAGAGAGAA
AATGTAAAATTAAATTCTTTTTTAAATGATAGATATGTAGTTTCTGAGTTGATGGAGACA
GATTTAGCATCAATTATAAAAAGTGAACAACCACTTACTGATGAGCATTGTCAATTCTTC
CTATACTAAATCCTTCGTGGTTTAAAATATATACATTCAGCAAAGGTCGTTCATCGTGAC
TTAGTATGCAAAATTTGATTTATTTAACAATTCAAAGTGGGTTACTAGATATATTTTTTG
AAATTTTTATAAAATTTATCTTAAAATTTAATTTAAAAATGCTTTAAGAAAATAATAAAT
TTTCTCTTTTTGATAAATAAATCTAGTTTACTTTGCTAAAAATCCAATTTAAAAAGTATT
TTTGATCTAAATTTTCAAAATTAATTTCATTTATTTAATTAATATTTTTATTAATCATTA
TTATTTGTATCAGAAACCTAGAAATTTGCTTGTAAATTCTAACTGTGATTTAAAAATTTG
TGATTTTGGTTTAGCTAGAACAATTATTCCTGGGCTAAAGTGTAGAGCTGGTATGCTAAC
AGATTATGTTGCAACCAGGTGGTATAGAGCCCCAGAACTTCTTTTATCTTGGAGAGACTA
TGATGAAAAAGGTACTTTCACTTTTCAAAACAAGAAAAAATTGAATATTTTTGCATTAAA
AATAAAAAATAGTTGATGTCTGGTCGGTAGGTTGTATTTTTGCAGAACTATTGAGAAGAA
AACCATTTTTACCAGGAATAGATAGTAAAAAATAAACTAAATTACTTTCTTAAAATACTT
AAATAAAATTAATTTAAAATAAACAGCAAGAAATCAAATAGAGCTTATTTTTGAGTATCT
GGGTACTCCTAGTGAATAAGAAATAAATAATATTCCAAGAGAAAAGTTTAGAAAAATGGT
TAAAAACATGCCTAAGAGATAGCCAAAGCAGTTTGAAAAATTATTCAGCAAAGCCTCAAA
AGAAGGTAAAACCAGATATTAAATATTTAAATTATCTACTTAAATCAAATTAAATTGTAT
AAAAAAAGCAATTGATTTACTTAGAAAACTTTTGACTTTTGATTTCACAAAAAGAATTAC
CGTAGATGAAGCTTTAAGCCATCCTTATTTATCTGAATTGCATTTCCCTGAAGATGAAGT
GAGAATTTAACTTATTCTTAATTTATAAATTAACTTATATTTTTAATTTCATAAAAATAT
ATTTTCTTATTAAAAATAGCCAACATGTGAGCCTGTTTCTAAGCTTGATTTTGAATTTGA
AGAGCATAATCTTACTTTACAGTAATTAAAAGGTAAAATAATAACAAGTAAATTTGTTTC
TAAAATATTTTATTGAAAAATAGACCTCATATACGAAGAAATATTATATTATCACTATCC
CTCATTTAAACAAGAATACGAAACTAAAAAAGCAAATGGTTAGTCTCTTATTTCTCATAT
CATAAATAATGCTAATAGAAATGTGGTAAACAATATTTTCATTAAAAACAAAAAACCAAA
TTAACAATAACATATTAAAAGCCTGATCCCCACTCGAGCGATGATGATTAAAGTGATGAT
GATGACGAAAATTGA