Identifiers and Description

Gene Model Identifier

TTHERM_00535470

Standard Name

MPH1 (Mutator PHenotype)

Aliases

PreTt03132 | 69.m00174 | 3718.m00036

Description

Type III restriction enzyme, res subunit family protein. Homolog to yeast MPH1 and human FANCM (a human Fanconi anemia complementation group protein)

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Domains

  • ( PF03066 ) Nucleoplasmin
  • ( TIGR01612 ) rhoptry protein
  • ( PF00270 ) DEAD/DEAH box helicase
  • ( PF00176 ) SNF2 family N-terminal domain
  • ( TIGR01587 ) CRISPR-associated helicase Cas3
  • ( TIGR00864 ) polycystin cation channel protein
  • ( PF00271 ) Helicase conserved C-terminal domain
  • ( PF07554 ) Uncharacterised Sugar-binding Domain
  • ( PF08957 ) Protein of unknown function (DUF1862)
  • ( PF05316 ) Mitochondrial ribosomal protein (VAR1)
  • ( PF03354 ) putative phage terminase, large subunit
  • ( PF04851 ) type III restriction enzyme, res
  • ( TIGR00614 ) ATP-dependent DNA helicase, RecQ family

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.6%

TetraMine Data

TTHERM_00535470

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_11193.19.997093137033517e-262type III restriction enzyme, r
es subunit protein (1818 aa)
OxytrichaContig1332.1.g1247.001811683013561e-96Type III restriction enzyme, r
es subunit
SGDYIR002C1.000499495426459e-47MPH1 Member of the DEAH family
of helicases, functions in an
error-free DNA damage bypass
pathway that involves homologo
us recombination, binds to fla
p DNA and stimulates activity
of Rad27p and Dna2p; mutations
confer a mutator phenotype
DictyBaseDDB_G02748411.9991939848149086e-44fncM on chromosome: 2 position
4112099 to 4117807
WormBaseWBGene000009390.000000019990673443141236locus:dcr-1 Endoribonuclease
dcr-1 status:Partially_conf
irmed UniProt:P34529 prote
in_id:CCD71200.2

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00535470(coding)
ATGAACGATGATGAAAACAGTAAATCTTCTAATGCGTTTGAAGCAATAATGAACACTAAT
TAGAAGAAGATTATAAAAGAAAAAAAAACTATTTTAAAACCCAAAGATAAGAAAAAAACT
AAGCAAATTCAAATGAATGATTTTATAAAAGCCAATAAATTTTATTCTGAGGAGTTCTCT
AACATGTCTCTTCCCTCTTAATGTGATAAAGTTGGTAATTAAGACAGTAACAGGTTTAGT
ATAATGGATGAAGAAGAGGAGGAGGCTAAATAAGAGAGCAATATTGATGTTATTGATTTC
TAAGGCTATTCAAATACAAAATTAAATCCTTCTCCTAATTCAGGCCTTGAACCAAATCTT
GAAGTCAATCAAAATACTATTCAATATTGGTATTATACACTGGGTAAAAGCTTTCGTGAG
TACTAATATAGTATTGTTAAGACATGCTTGAGCAATAATACCCTTGTAGCTTTACCAACA
GGTTTGGGAAAAACATTTATTGCTGCAACTGTTATTTTAAATTATTATCTTTGGTTTCCA
AAAGGGAAGATTTTTTTTCTTGCTCCTACCAGACCACTTGTAAATTAATAAATGGAATGC
CTCAGCCAATTTGAATTGATCAATAAAAATGATATTTTTGAAATGACAGGAAATTACCCA
ATACCTAAAAGAAGAGATGTATATTTAAGAAAAAGAATTTTCTTTTGCACTCCATAAACC
TTAGAAAATGATTTAATTGAATAAAGATATGATGGATATAATTTAAGTCTAGTTATATTT
GATGAAGCCCATAGAGGAACGGGAAAGTATGCATATGTCAATATCGTTACACACTTCGAA
TCATTAGGCTACGGGTATAGAATTTTAGCATTGAGCGCCACTCCAGGAAATGAATTTGAA
TAAATATAAGATGTTTTAAAAAACTTACGTATTTCTAAGCTAGAAATTAAAGATGAAGAA
GATCCTGATATTAAGTAGTATATCCATTCAAAATAAATTATACCAGTAAAAATCTAGGGT
AATGACTTAATGACCAAAATTATGAGTTACCTTGATAATCTGCTGTATTCCAGATTCAAT
TACTTCAAAAATCTTTAGATGGTACCCATATAGCTTTACAAAATAGTTAAAAAACCCTCT
GATATACAGCGTGGTACTTCTTTCCATATTATGGAGTTTATTAAATAAAATTAGAATGAT
ATAATTGAAAAACATCATTAAGTAGGATTGAATGATGCTTACGACTAATTACAGTCTTTC
TCACAATTAATTCATGGAAAAAAGCTTATTTAAGAATAAGGAATAAACTGCTTTAAGGAT
TGGTTATACTAATTTGAAAAAGATGTAAATAATAAGAAAGGGAAACCTTTGAGAAGCAAG
CTTTAAATATTTAAATTGTAGGACTTCATTGATTTAAAAAAAGTAATGAAAATGGATTAA
TATGTTCCAAAATAAAAAAAACCAAAGAAAAATAAATCTGCAACTAATTCAAAATAATTA
AATTACTAAGATGATGATGATGGTTATGAAGATGAAAATGCTCCATTAAAACAAAACAAT
AAAAGTTCAAAAGGCTCTGAAGAAAATTTTGATGAAGTCGAACTCAGTGAAGATTTAGAA
TCACATCCTAAGAGTGAAAAGCTTGTGGAACTCTTAACAAACTACTTCTTAGAAGAGGAG
TCAATAGTAAATAGATCTAAAACAATTATTTTTACTTAAAGTAGAAACTCAGCATCTGAA
TTAAAAAAACTATTAAACAATATTGATGTTGTTAATCCTGCTGGAGATAAGCTTATAAGA
AGTGAAATATTTATTGGATAAGCAAATTTAGACGGACAAGGAATGAATCAAAAAGCTTAG
ATAGAAACTATAAAATTATTTAAATAAAATGTTTACAATACTCTGATTGCTACTTGCATA
GGTGAAGAAGGTCTTGATATTGGTGAAGTAGATCTAATTGTCTGCTATGATTCAGGATTT
TCTCCTATAAGAATGATATAGAGAATGGGTAGAACAGGCAGAAAAAGAGCTGGAAAAGTC
TATGTCCTGTTAATGGAAGGAAGGGAGTACGCAAACTACAACTAAAGCTAAAAAAAACAC
AAAGAACTTATGATGCTATTAAAAAATAATAGCTGCAGCTAAAGTGTTACTGATTTTCAA
TAAAAGGGTCGGACTGGTAGATAGCCAAAAGCGACAAAAAGAACTTTTGAATTTTATGGA
TTCAACCCAAGGATGATACCATAAGACGTAAATCCTATTTGCAGAATAATAAAAGGTTAG
AATAATGACTTTACTCCTGCTATTAGCTCTTAATCAGAAAGTGAATAAGAGGATTTTTTT
GAGTTTTAGGGAAGTAAACAAAATAAAGAAAAATAATCAAATTAAATTTAAAAGAAAAAA
TCAATTATTTAATTGGAAGTAGAAGAGGAGGAGGAAGAGGAATAATTATTTAAAGTTGAA
ATAAAAAAAGATTTAGAAGATTAATATTGCTACGAAATAGACGAAGAAGATTTTGAGCCG
CCATAATATCTAATGAAACCTTCATTTGAAAAGCCTAAACAAAGTTTAGAAAAAACTTAA
AAATAATAGGAAATTTAGGATAGATTATTGCAATTAGCTAATAATATAAATGGGAAAAGA
TAATAACCTCCTCCAATAAAATAACCTTAGATACCTTAATAAAAGATCATGAGCACTCCT
GAAACTATGACTCCATTCAGCAATTTCAGTAGCAACGAAAAGTTTATGAGAAACAGCTCA
AATGGAAATAAAAAATAAACTTCTGTATTTGATACAAATATTAAAAGATCTTCTACTACA
AATTAGTTACGAAAATCTGATCCTAAATAAATTACTAAAATACCTTTAAAGAGTAATTCT
AAAAAAAATAGATTAATTATAAGTGATTCTGAAAACATGGAAAACGATGAATTAAATAGT
GATTTGTGTTCGAACTTTAAATAATAATGCTCACGTCAGCTAGATTTTAACTCAAACAAT
CCAATTTCTAACTTAGAAAGAATTAATTTACATAATTCTTATGATAAATAGAATGATGAT
GAAATAGTCTTTGTTAAAAAGTTGAATCCTCTTCATGTATTTGGAAATATAGAATAAGAA
AAAAAGAGTGTGATGAAAAAAAGATCAAATTCAAAAAGTTCTTCAGATTTTAATTTAAAT
GATTATTCTCTACTCTACTAAAATGAAGAATAAAGCAACTAATCTGAGTTAGACAGCTTA
CTAAAGCAAATAGAATAAAACTCTCCATAAAAAACTTAAAATCACAATTAAAATCAAATA
TAGAAATTTAACTTCAATTAGTTTGAATAAGATGATGATGACGACGACGATGATGATGAT
GATGATGATGATGAAGATGATAAGCAAATCTTAGAATTTCTTAAAAATTCAAAGAGCTAG
GCTTCAAATGTAAATAACCAAATTTAAGATCAAAGACAAGAAAAAAATTTAATATAAAAT
ATGCCATAAAAATCATTTGCTGAAGATAAATTATTTCCCTCTAATATAAAATAATAATAA
AATAAATTTGAATAAAAATAATAGGAATAAGTTTAAAAATAGCAAATTTACAATTAAACA
TATAATATATAATTAAATTAATAACAAAATAACCTTAATATCAACAACAAAAATAGTAAT
AATATCAATTATAGCAACAGTATAATAAACTAATAAAAAGAAAATATTTCTCAATAAATT
CCACTAAATACTTGCAAAGAAAGTTAATAATAGTTCCTTAATGTTAACAATGTCTTTTAA
CAAAAAGGATTAACTTTACAAAATCAATAGAAAGTTGCTGAAAGTTAAAAAAAAAATTTT
TTAAATAATGATTTATCAAATGCTGTAAATTTTTCAAAAATGATAGATGAAAATGATAGT
GATGATGATGACGATGATGATGAAGATATTGATTTCTTAAAAAAAATAGCTAGCACTAAA
AGCAGTGTATAATAATCTGTTTAGAATAATTAGTTTACGAATCCATCGAATTCAAATAAG
AGTATTGAAAAAATGGAAATAGAATAAATCTAAAACTCGAAGCCTGTCTCTTTATAAACA
AATAAAGCTGAATAGAAAAATGAATTATAAAATAATTAAATATTAAATTCAAAATAATCT
TAGATTAGCAATATTTTAACAAATGTTTATGATCATGATAGTGATAGTGATAGCGATAGT
GATGAAGATAATGTTGAAGACTTAAAAATAATCAGCCTAAACATTTTTAACAAAAACAGT
TCTAATTTAAATATTCAAACAAATAATAATTAAATATCAAAGAAAGTTGAGTTAGATTCC
ATTTCGTATAGTTCACTAAACTTACTGAATACATAAAATAACTCAAAAGCTCCAAATAAC
TAGGCAACTCTAAATAATTGTTAAGTCTAAAATAGCTTAATCGAAAAAATACCAGAAGCA
AATAATTTTAAGAATAACTTCTTTAACAACTAAAAAGATATTAATGTAAATAATAATTAA
ATTAAATTAAATAATGACTAAAATAATTAAAAATAAATCTAACTTGCTTAAATTAATGCA
AATAGACTATAAAATGCTGCAGCATCTACCAGCAATAATGAGAAATTCATTCAACCTTAA
ATTAACAACAATCCTTAAATGAATTAAATAAACAAACAAAATAATATAAATGCTAATAAC
TTAGAATAAAATAAGAATACTACGAGCAATATAAATAACAACTAAGTCAATATTTTAAAA
AATTTTAGTGGTATTAAAAATGTAATACAAGACAAGACTAAATAAGTTATATAAATCAAT
AATTAAAATATTATTATTTCTAATGTTTAGAATTAAAATAAGTAAAACAATAATATTAGT
TAAGTACAAAGCAACTTGAACTAACAAAGCAAGAATTAATTTAATAACATTCCATTTAAT
CAAAAAAATTAATAGGAGCAGTTATAAAATAAATAATAAATATTTGGAAACTAAAATTAA
ATTAATAATGTCACAAAAAATGAATTAAAAAGAAGTGATAGTGATTCATAGATAAAATAA
TTGCAAGAAAACTAAAAAGAGTTGCAATCCTAAAGAAAAACAGCTTGTGATTTACATCTA
GAATAGATTAAGAAGAAAATGCAAGAAGATTTTGACATTGAAGAGTACAATTAAAGAAAT
AAAAATAAAGTTGCTGAATAACTTAAACCTAAACTTGATCCAAAAAAAGCTAGAAAAGCT
AAAAAAGAAAATCAAAATAAGTAAGATTCAAATATAAATTTAAATGTGGAATAAAAAAGC
TAAGATTTTAAATCAGTTTAGTAAATAGCTGAAGAGATGAGATAAAAAAATATTTAAGAA
TAAAATAGCTAAATAAGTAAACTTAATGATGAGAATAAGAATGGTATCTAAATAATAAAT
TCTTAAAGTGTTGTTAATCCTATAAATAAAAAATAAAATGAAAATATTTAACCAATTCAA
GATAATCTAAAATAAGATCATTTAATGCCATTCAAAGATTTATTATCTTGCATCTATGAT
AGTGATGAAGATGACAATGATGCAGCAAAATAAGATGATAAAATGTAAGATTTATAAACT
GAATAACATAATTCAGATTAATAAAAGAAAAAAAGAGAAAATCCTTTCCTAGATAATCCT
AACTCTACATATAACTCGGTTAAAGTAGAGAAAAAATAATTCCCAAAATAGTGA


>TTHERM_00535470(protein)
MNDDENSKSSNAFEAIMNTNQKKIIKEKKTILKPKDKKKTKQIQMNDFIKANKFYSEEFS
NMSLPSQCDKVGNQDSNRFSIMDEEEEEAKQESNIDVIDFQGYSNTKLNPSPNSGLEPNL
EVNQNTIQYWYYTLGKSFREYQYSIVKTCLSNNTLVALPTGLGKTFIAATVILNYYLWFP
KGKIFFLAPTRPLVNQQMECLSQFELINKNDIFEMTGNYPIPKRRDVYLRKRIFFCTPQT
LENDLIEQRYDGYNLSLVIFDEAHRGTGKYAYVNIVTHFESLGYGYRILALSATPGNEFE
QIQDVLKNLRISKLEIKDEEDPDIKQYIHSKQIIPVKIQGNDLMTKIMSYLDNLLYSRFN
YFKNLQMVPIQLYKIVKKPSDIQRGTSFHIMEFIKQNQNDIIEKHHQVGLNDAYDQLQSF
SQLIHGKKLIQEQGINCFKDWLYQFEKDVNNKKGKPLRSKLQIFKLQDFIDLKKVMKMDQ
YVPKQKKPKKNKSATNSKQLNYQDDDDGYEDENAPLKQNNKSSKGSEENFDEVELSEDLE
SHPKSEKLVELLTNYFLEEESIVNRSKTIIFTQSRNSASELKKLLNNIDVVNPAGDKLIR
SEIFIGQANLDGQGMNQKAQIETIKLFKQNVYNTLIATCIGEEGLDIGEVDLIVCYDSGF
SPIRMIQRMGRTGRKRAGKVYVLLMEGREYANYNQSQKKHKELMMLLKNNSCSQSVTDFQ
QKGRTGRQPKATKRTFEFYGFNPRMIPQDVNPICRIIKGQNNDFTPAISSQSESEQEDFF
EFQGSKQNKEKQSNQIQKKKSIIQLEVEEEEEEEQLFKVEIKKDLEDQYCYEIDEEDFEP
PQYLMKPSFEKPKQSLEKTQKQQEIQDRLLQLANNINGKRQQPPPIKQPQIPQQKIMSTP
ETMTPFSNFSSNEKFMRNSSNGNKKQTSVFDTNIKRSSTTNQLRKSDPKQITKIPLKSNS
KKNRLIISDSENMENDELNSDLCSNFKQQCSRQLDFNSNNPISNLERINLHNSYDKQNDD
EIVFVKKLNPLHVFGNIEQEKKSVMKKRSNSKSSSDFNLNDYSLLYQNEEQSNQSELDSL
LKQIEQNSPQKTQNHNQNQIQKFNFNQFEQDDDDDDDDDDDDDDEDDKQILEFLKNSKSQ
ASNVNNQIQDQRQEKNLIQNMPQKSFAEDKLFPSNIKQQQNKFEQKQQEQVQKQQIYNQT
YNIQLNQQQNNLNINNKNSNNINYSNSIINQQKENISQQIPLNTCKESQQQFLNVNNVFQ
QKGLTLQNQQKVAESQKKNFLNNDLSNAVNFSKMIDENDSDDDDDDDEDIDFLKKIASTK
SSVQQSVQNNQFTNPSNSNKSIEKMEIEQIQNSKPVSLQTNKAEQKNELQNNQILNSKQS
QISNILTNVYDHDSDSDSDSDEDNVEDLKIISLNIFNKNSSNLNIQTNNNQISKKVELDS
ISYSSLNLLNTQNNSKAPNNQATLNNCQVQNSLIEKIPEANNFKNNFFNNQKDINVNNNQ
IKLNNDQNNQKQIQLAQINANRLQNAAASTSNNEKFIQPQINNNPQMNQINKQNNINANN
LEQNKNTTSNINNNQVNILKNFSGIKNVIQDKTKQVIQINNQNIIISNVQNQNKQNNNIS
QVQSNLNQQSKNQFNNIPFNQKNQQEQLQNKQQIFGNQNQINNVTKNELKRSDSDSQIKQ
LQENQKELQSQRKTACDLHLEQIKKKMQEDFDIEEYNQRNKNKVAEQLKPKLDPKKARKA
KKENQNKQDSNINLNVEQKSQDFKSVQQIAEEMRQKNIQEQNSQISKLNDENKNGIQIIN
SQSVVNPINKKQNENIQPIQDNLKQDHLMPFKDLLSCIYDSDEDDNDAAKQDDKMQDLQT
EQHNSDQQKKKRENPFLDNPNSTYNSVKVEKKQFPKQ


>TTHERM_00535470(gene)
ATGAACGATGATGAAAACAGTAAATCTTCTAATGCGTTTGAAGCAATAATGAACACTAAT
TAGAAGAAGATTATAAAAGAAAAAAAAACTATTTTAAAACCCAAAGATAAGAAAAAAACT
AAGCAAATTCAAATGAATGATTTTATAAAAGCCAATAAATTTTATTCTGAGGAGTTCTCT
AACATGTCTCTTCCCTCTTAATGTGATAAAGTTGGTAATTAAGACAGTAACAGGTTTAGT
ATAATGGATGAAGAAGAGGAGGAGGCTAAATAAGAGAGCAATATTGATGTTATTGATTTC
TAAGGCTATTCAAATACAAAATTAAATCCTTCTCCTAATTCAGGCCTTGAACCAAATCTT
GAAGTCAATCAAAATACTATTCAATATTGGGTATAGTCTTATATATTAAAATATTATCTT
CTTTTAATATTGTTAAAATTTTCTTGTTATATCATCTGAATTATGCAACATCATCATATT
TTCATTTGAATAAATGAGAAGATAAACTATTTCTTAGAATAATTTTTAAATTTATTTGAT
TTTATCTCTTGTCTTAACTTTATTTAAATTCTACTTGTTTAATAAATAATAGTATTATAC
ACTGGGTAAAAGCTTTCGTGAGTACTAATATAGTATTGTTAAGACATGCTTGAGCAATAA
TACCCTTGTAGCTTTACCAACAGGTTTGGGAAAAACATTTATTGCTGCAACTGTTATTTT
AAATTATTATCTTTGGTTTCCAAAAGGGAAGATTTTTTTTCTTGCTCCTACCAGACCACT
TGTAAATTAATAAATGGAATGCCTCAGCCAATTTGAATTGATCAATAAAAATGATATTTT
TGAAATGACAGGAAATTACCCAATACCTAAAAGAAGAGATGTATATTTAAGAAAAAGAAT
TTTCTTTTGCACTCCATAAACCTTAGAAAATGATTTAATTGAATAAAGATATGATGGATA
TAATTTAAGTCTAGTTATATTTGGTAAATATACAATTATTAAAGCAATAATTCTTACTTT
AATCAGTATTATAATTTAAAATATTTTAATTTAGATGAAGCCCATAGAGGAACGGGAAAG
TATGCATATGTCAATATCGTTACACACTTCGAATCATTAGGCTACGGGTATAGAATTTTA
GCATTGAGCGCCACTCCAGGAAATGAATTTGAATAAATATAAGTAAAATTTAATATTTAT
TTTTAAGAAATATATTTTAAAGTTAATTTTAGAAATATTTAGAAATTATTTTGCTTAAAA
AACTTGTGAAAAATAATTTATTTAGATGTCAAATTAGATTAAAAATAATTTACCTTGTTT
ATATTTTTGTTATTTTTAAAATAGGATGTTTTAAAAAACTTACGTATTTCTAAGCTAGAA
ATTAAAGATGAAGAAGATCCTGATATTAAGTAGTATATCCATTCAAAATAAATTATACCA
GTAAAAATCTAGGGTAATGACTTAATGACCAAAATTATGAGTTACCTTGATAATCTGCTG
TATTCCAGATTCAATTACTTCAAAAATCTTTAGATGGTACCCATATAGCTTTACAAAATA
GTTAAAAAACCCTCTGATATACAGCGTGGTACTTCTTTCCATATTATGGAGTTTATTAAA
TAAAATTAGAATGATATAATTGAAAAACATCATTAAGTAGGATTGAATGATGCTTACGAC
TAATTACAGGTATTTATTGAATATTTTATTTTAAATGTCTTTTAGAATTTTTAATATTAG
ATAAAAGATTTTATTTAATTTTTTGATATGAATTACAAGCTAGATAATATTAAACAAATT
ATTATTAGTTAAATAAACTAATAAAAATGTATTTAATAAGTAAATATTTTAAATTAATTA
CTTTTTAAAAAAAAGTCTTTCTCACAATTAATTCATGGAAAAAAGCTTATTTAAGAATAA
GGAATAAACTGCTTTAAGGATTGGTTATACTAATTTGAAAAAGATGTAAATAATAAGAAA
GGGAAACCTTTGAGAAGCAAGCTTTAAATATTTAAATTGTAGGACTTCATTGATTTAAAA
AAAGTAATGAAAATGGATTAATATGTTCCAAAATAAAAAAAACCAAAGAAAAATAAATCT
GCAACTAATTCAAAATAATTAAATTACTAAGATGATGATGATGGTTATGAAGATGAAAAT
GCTCCATTAAAACAAAACAATAAAAGTTCAAAAGGCTCTGAAGAAAATTTTGATGAAGTC
GAACTCAGTGAAGATTTAGAATCACATCCTAAGAGTGAAAAGCTTGTGGAACTCTTAACA
AACTACTTCTTAGAAGAGGAGTCAATAGTAAATAGATCTAAAACAATTATTTTTACTTAA
AGTAGAAACTCAGCATCTGAATTAAAAAAACTATTAAACAATATTGATGTTGTTAATCCT
GCTGGAGATAAGCTTATAAGAAGTGAAATATTTATTGGATAAGCAAATTTAGACGGACAA
GGAATGAATCAAAAAGCTTAGATAGAAACTATAAAATTATTTAAATAAAATGTTTACAAT
ACTCTGATTGCTACTTGCATAGGTGAAGAAGGTCTTGATATTGGTGAAGTAGATCTAATT
GTCTGCTATGATTCAGGATTTTCTCCTATAAGGTATATTTATTTAGAATTTTCTTCTATA
AGGAAATGTATTTGAATTCTATTATTAAAAAAGAATGATATAGAGAATGGGTAGAACAGG
CAGAAAAAGAGCTGGAAAAGTCTATGTCCTGTTAATGGAAGGAAGGGAGTACGCAAACTA
CAACTAAAGCTAAAAAAAACACAAAGAACTTATGATGCTATTAAAAAATAATAGCTGCAG
CTAAAGTGTTACTGATTTTCAATAAAAGGGTCGGACTGGTAGATAGCCAAAAGCGACAAA
AAGAACTTTTGAATTTTATGGATTCAACCCAAGGATGATACCATAAGACGTAAATCCTAT
TTGCAGAATAATAAAAGGTTAGAATAATGACTTTACTCCTGCTATTAGCTCTTAATCAGA
AAGTGAATAAGAGGATTTTTTTGAGTTTTAGGGAAGTAAACAAAATAAAGAAAAATAATC
AAATTAAATTTAAAAGAAAAAATCAATTATTTAATTGGAAGTAGAAGAGGAGGAGGAAGA
GGAATAATTATTTAAAGTTGAAATAAAAAAAGATTTAGAAGATTAATATTGCTACGAAAT
AGACGAAGAAGATTTTGAGCCGCCATAATATCTAATGAAACCTTCATTTGAAAAGCCTAA
ACAAAGTTTAGAAAAAACTTAAAAATAATAGGAAATTTAGGATAGATTATTGCAATTAGC
TAATAATATAAATGGGAAAAGATAATAACCTCCTCCAATAAAATAACCTTAGATACCTTA
ATAAAAGATCATGAGCACTCCTGAAACTATGACTCCATTCAGCAATTTCAGTAGCAACGA
AAAGTTTATGAGAAACAGCTCAAATGGAAATAAAAAATAAACTTCTGTATTTGATACAAA
TATTAAAAGATCTTCTACTACAAATTAGTTACGAAAATCTGATCCTAAATAAATTACTAA
AATACCTTTAAAGAGTAATTCTAAAAAAAATAGATTAATTATAAGTGATTCTGAAAACAT
GGAAAACGATGAATTAAATAGTGATTTGTGTTCGAACTTTAAATAATAATGCTCACGTCA
GCTAGATTTTAACTCAAACAATCCAATTTCTAACTTAGAAAGAATTAATTTACATAATTC
TTATGATAAATAGAATGATGATGAAATAGTCTTTGTTAAAAAGTTGAATCCTCTTCATGT
ATTTGGAAATATAGAATAAGAAAAAAAGAGTGTGATGAAAAAAAGATCAAATTCAAAAAG
TTCTTCAGATTTTAATTTAAATGATTATTCTCTACTCTACTAAAATGAAGAATAAAGCAA
CTAATCTGAGTTAGACAGCTTACTAAAGCAAATAGAATAAAACTCTCCATAAAAAACTTA
AAATCACAATTAAAATCAAATATAGAAATTTAACTTCAATTAGTTTGAATAAGATGATGA
TGACGACGACGATGATGATGATGATGATGATGATGAAGATGATAAGCAAATCTTAGAATT
TCTTAAAAATTCAAAGAGCTAGGCTTCAAATGTAAATAACCAAATTTAAGATCAAAGACA
AGAAAAAAATTTAATATAAAATATGCCATAAAAATCATTTGCTGAAGATAAATTATTTCC
CTCTAATATAAAATAATAATAAAATAAATTTGAATAAAAATAATAGGAATAAGTTTAAAA
ATAGCAAATTTACAATTAAACATATAATATATAATTAAATTAATAACAAAATAACCTTAA
TATCAACAACAAAAATAGTAATAATATCAATTATAGCAACAGTATAATAAACTAATAAAA
AGAAAATATTTCTCAATAAATTCCACTAAATACTTGCAAAGAAAGTTAATAATAGTTCCT
TAATGTTAACAATGTCTTTTAACAAAAAGGATTAACTTTACAAAATCAATAGAAAGTTGC
TGAAAGTTAAAAAAAAAATTTTTTAAATAATGATTTATCAAATGCTGTAAATTTTTCAAA
AATGATAGATGAAAATGATAGTGATGATGATGACGATGATGATGAAGATATTGATTTCTT
AAAAAAAATAGCTAGCACTAAAAGCAGTGTATAATAATCTGTTTAGAATAATTAGTTTAC
GAATCCATCGAATTCAAATAAGAGTATTGAAAAAATGGAAATAGAATAAATCTAAAACTC
GAAGCCTGTCTCTTTATAAACAAATAAAGCTGAATAGAAAAATGAATTATAAAATAATTA
AATATTAAATTCAAAATAATCTTAGATTAGCAATATTTTAACAAATGTTTATGATCATGA
TAGTGATAGTGATAGCGATAGTGATGAAGATAATGTTGAAGACTTAAAAATAATCAGCCT
AAACATTTTTAACAAAAACAGTTCTAATTTAAATATTCAAACAAATAATAATTAAATATC
AAAGAAAGTTGAGTTAGATTCCATTTCGTATAGTTCACTAAACTTACTGAATACATAAAA
TAACTCAAAAGCTCCAAATAACTAGGCAACTCTAAATAATTGTTAAGTCTAAAATAGCTT
AATCGAAAAAATACCAGAAGCAAATAATTTTAAGAATAACTTCTTTAACAACTAAAAAGA
TATTAATGTAAATAATAATTAAATTAAATTAAATAATGACTAAAATAATTAAAAATAAAT
CTAACTTGCTTAAATTAATGCAAATAGACTATAAAATGCTGCAGCATCTACCAGCAATAA
TGAGAAATTCATTCAACCTTAAATTAACAACAATCCTTAAATGAATTAAATAAACAAACA
AAATAATATAAATGCTAATAACTTAGAATAAAATAAGAATACTACGAGCAATATAAATAA
CAACTAAGTCAATATTTTAAAAAATTTTAGTGGTATTAAAAATGTAATACAAGACAAGAC
TAAATAAGTTATATAAATCAATAATTAAAATATTATTATTTCTAATGTTTAGAATTAAAA
TAAGTAAAACAATAATATTAGTTAAGTACAAAGCAACTTGAACTAACAAAGCAAGAATTA
ATTTAATAACATTCCATTTAATCAAAAAAATTAATAGGAGCAGTTATAAAATAAATAATA
AATATTTGGAAACTAAAATTAAATTAATAATGTCACAAAAAATGAATTAAAAAGAAGTGA
TAGTGATTCATAGATAAAATAATTGCAAGAAAACTAAAAAGAGTTGCAATCCTAAAGAAA
AACAGCTTGTGATTTACATCTAGAATAGATTAAGAAGAAAATGCAAGAAGATTTTGACAT
TGAAGAGTACAATTAAAGAAATAAAAATAAAGTTGCTGAATAACTTAAACCTAAACTTGA
TCCAAAAAAAGCTAGAAAAGCTAAAAAAGAAAATCAAAATAAGTAAGATTCAAATATAAA
TTTAAATGTGGAATAAAAAAGCTAAGATTTTAAATCAGTTTAGTAAATAGCTGAAGAGAT
GAGATAAAAAAATATTTAAGAATAAAATAGCTAAATAAGTAAACTTAATGATGAGAATAA
GAATGGTATCTAAATAATAAATTCTTAAAGTGTTGTTAATCCTATAAATAAAAAATAAAA
TGAAAATATTTAACCAATTCAAGATAATCTAAAATAAGATCATTTAATGCCATTCAAAGA
TTTATTATCTTGCATCTATGATAGTGATGAAGATGACAATGATGCAGCAAAATAAGATGA
TAAAATGTAAGATTTATAAACTGAATAACATAATTCAGATTAATAAAAGAAAAAAAGAGA
AAATCCTTTCCTAGATAATCCTAACTCTACATATAACTCGGTTAAAGTAGAGAAAAAATA
ATTCCCAAAATAGTGA