Identifiers and Description

Gene Model Identifier

TTHERM_00075580

Standard Name

MPCE1 (Methyl-Phosphate Capping Enzyme)

Aliases

PreTt10002 | 5.m00353 | 3828.m01265

Description

Putative methylphosphate capping enzyme, homologous to human MEPCE1

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF06859 ) Bicoid-interacting protein 3 (Bin3)
  • ( PF05316 ) Mitochondrial ribosomal protein (VAR1)

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.9%

TetraMine Data

TTHERM_00075580

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_07154.19.997093137033517e-262hypothetical protein (509 aa)
OxytrichaContig17474.0.g704.0006511639687014e-23Bicoid-interacting protein 3 (
Bin3)
DictyBaseDDB_G02679544.999245259173412e-21DDB_G0267954 on chromosome: 1
position 1175758 to 1177189
WormBaseWBGene000124695.999654353873483e-20Probable RNA methyltransferase
Y17G7B.18 status:Partially_
confirmed UniProt:Q9U2R0 p
rotein_id:CAA19465.1
Stentor CoeruleusSteCoe_16100.0000000000006914400106940203

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:SUPR000106

Sequences

>TTHERM_00075580(coding)
ATGAAAAGAAAGGCAAGATTAAATTTTAGTACTGACTATTTACCTATAGGCTAGCATTAA
ACTAGTAAGAGAGTACATAGAGAAACTGAAGAGGATGATGAATAGCAAAATAAAACTAAT
TGTGATAGGTTATAGGAAGAATAAAGTAATTAAAATCATACTTAAGGTGAAGAAAATAAT
ATTTAGATTGACTAAGATAAACCTTTAAGAGAAAAACGAGCAATTTAGGATGATTCAAGC
AAAGTAGAATCAGTTGAAGAAATTATTTAAAGAAAATTATCAACAAATCCAATAAATTTA
ATCAAACAAGGTAAAGAAAATTAATATGGAAACTTTAGAAGCTACTATGATCACAGATAC
GAAAAGAAATGGAGTGATCCAAGATTAAAGGTTTTAGATAGAAATTGGTTTTTAAACAAG
GAAGTTCTAGATATAGGATGTAATGATGGGTCCCTGACATTACTGATTGCAATAAAGTAC
TTTCCATTTAAAATAGTTGGAATTGATATTGATTTCAATCTGATTAATAAAGCTGTAGGT
AATTATAATTTGTTAGAAAAGGAGTAGTCTAAATGCAAAAGCAGCTGCAACGAACACAGT
GAGGATAATAATAGCTCTTAGAATTAGTAAGATAACTATAAAAAAATTAAAGATAAACTG
AGTAAGATCCCTAAAAGTTATTTAATTGATAGGAGTAAATAAAATGAAAAATTAAAAGAG
ATGTTTCTCAAAAAAAATGCTGACAACATATTATAAAATCCTGATTCTAATCACTTTTAA
ATGGAACTTGAAAAGCCATAAGGTCATACAAATTTAATTGGCAATAATGATAGCTTAAAT
AACAAAGATAATTTAACTGAAAATATTTAAAATATCTAATAAAATTTGATATTATCTGAA
TTTAATAATGAATAAGCATAAACAGAAGATAAGAAATAAATTTAATGTTAAAATAACGAA
GAGGTTATCAAAGTTTAACAAGAAGATAGTCTTAAATAGTTAAACTAAGAAAATTAATTA
GAGAAGGATAAAGATTAAAAATTCAATGAGAGTAATGTTAAAATTTAAGAGGAATCTTAA
ACATTTGAGTAATAAACTGAATGTAAATAAAATTAGAATTTGAATAGTTAAGTTGATGAT
AATTAGTAAGAAAAAAAAGATGAAGACACTGAAAATATAAAAGATGAAACAAATAATTTA
AATAAAGAACTAACTTTAGAATAGCAAAATAATGTTAGCAGCGAACACACATAAGTTTAG
TAAGAAGGAGATAACCAAATTTAAAGTTTTCCTTAGTAGATTGTGATTAAAAGAAGATTT
CCATAAAATACAAAATTTAGATTAGAAAATTATGTTGAGAGTACTGAGCTTACTGAGAAG
TTTGATACCATTTGCTGCTTTTCTACTACAAAATGGATTCACTTAAATTTTGGTGACTAA
GGTATAAAGAGACTATTTGATAAAGTGTATAGGAGTCTGAGAGTTAATGGAATTTTTATT
CTTGAACCATAAGAGTGGAGATCATATAAAAAGAAATAAAGTTTTAGTGAAGAATTTAGA
TAAATACTCAAATCAATCAAGTTGCATCCAGGAGAATTCAAGCAACATTTATTGGAAAAT
TACAAATTTATCTTGGAAAAAGAAATTATACCTGAGCTCAACAGTAATAAGGTTCCTGCC
TTTTTCAAAAGAGTTGTCTATGTTTTTAGAAAAGTTGAATGA


>TTHERM_00075580(protein)
MKRKARLNFSTDYLPIGQHQTSKRVHRETEEDDEQQNKTNCDRLQEEQSNQNHTQGEENN
IQIDQDKPLREKRAIQDDSSKVESVEEIIQRKLSTNPINLIKQGKENQYGNFRSYYDHRY
EKKWSDPRLKVLDRNWFLNKEVLDIGCNDGSLTLLIAIKYFPFKIVGIDIDFNLINKAVG
NYNLLEKEQSKCKSSCNEHSEDNNSSQNQQDNYKKIKDKLSKIPKSYLIDRSKQNEKLKE
MFLKKNADNILQNPDSNHFQMELEKPQGHTNLIGNNDSLNNKDNLTENIQNIQQNLILSE
FNNEQAQTEDKKQIQCQNNEEVIKVQQEDSLKQLNQENQLEKDKDQKFNESNVKIQEESQ
TFEQQTECKQNQNLNSQVDDNQQEKKDEDTENIKDETNNLNKELTLEQQNNVSSEHTQVQ
QEGDNQIQSFPQQIVIKRRFPQNTKFRLENYVESTELTEKFDTICCFSTTKWIHLNFGDQ
GIKRLFDKVYRSLRVNGIFILEPQEWRSYKKKQSFSEEFRQILKSIKLHPGEFKQHLLEN
YKFILEKEIIPELNSNKVPAFFKRVVYVFRKVE


>TTHERM_00075580(gene)
ATGAAAAGAAAGGCAAGATTAAATTTTAGTACTGACTATTTACCTATAGGCTAGCATTAA
ACTAGTAAGAGAGTACATAGAGAAACTGAAGAGGATGATGAATAGCAAAATAAAACTAAT
TGTGATAGGTTATAGGAAGAATAAAGTAATTAAAATCATACTTAAGGTGAAGAAAATAAT
ATTTAGATTGACTAAGATAAACCTTTAAGAGAAAAACGAGCAATTTAGGATGATTCAAGC
AAAGTAGAATCAGTTGAAGAAATTATTTAAAGAAAATTATCAACAAATCCAATAAATTTA
ATCAAACAAGGTAAAGAAAATTAATATGGAAACTTTAGAAGCTACTATGATCACAGATAC
GAAAAGAAATGGAGTGATCCAAGATTAAAGGTTTTAGATAGAAATTGGTTTTTAAACAAG
GAAGTTCTAGATATAGGATGTAATGATGGGTCCCTGACATTACTGATTGCAATAAAGTAC
TTTCCATTTAAAATAGTTGGAATTGATATTGATTTCAATCTGATTAATAAAGCTGTAGGT
AATTATAATTTGTTAGAAAAGGAGTAGTCTAAATGCAAAAGCAGCTGCAACGAACACAGT
GAGGATAATAATAGCTCTTAGAATTAGTAAGATAACTATAAAAAAATTAAAGATAAACTG
AGTAAGATCCCTAAAAGTTATTTAATTGATAGGAGTAAATAAAATGAAAAATTAAAAGAG
ATGTTTCTCAAAAAAAATGCTGACAACATATTATAAAATCCTGATTCTAATCACTTTTAA
ATGGAACTTGAAAAGCCATAAGGTCATACAAATTTAATTGGCAATAATGATAGCTTAAAT
AACAAAGATAATTTAACTGAAAATATTTAAAATATCTAATAAAATTTGATATTATCTGAA
TTTAATAATGAATAAGCATAAACAGAAGATAAGAAATAAATTTAATGTTAAAATAACGAA
GAGGTTATCAAAGTTTAACAAGAAGATAGTCTTAAATAGTTAAACTAAGAAAATTAATTA
GAGAAGGATAAAGATTAAAAATTCAATGAGAGTAATGTTAAAATTTAAGAGGAATCTTAA
ACATTTGAGTAATAAACTGAATGTAAATAAAATTAGAATTTGAATAGTTAAGTTGATGAT
AATTAGTAAGAAAAAAAAGATGAAGACACTGAAAATATAAAAGATGAAACAAATAATTTA
AATAAAGAACTAACTTTAGAATAGCAAAATAATGTTAGCAGCGAACACACATAAGTTTAG
TAAGAAGGAGATAACCAAATTTAAAGTTTTCCTTAGTAGATTGTGATTAAAAGAAGATTT
CCATAAAATACAAAATTTAGATTAGAAAATTATGTTGAGAGTACTGAGCTTACTGAGAAG
TTTGATACCATTTGCTGCTTTTCTACTACAAAATGGATTCACTTAAATTTTGGTGACTAA
GGTATAAAGAGACTATTTGATAAAGTGTATAGGAGTCTGAGAGTTAATGGAATTTTTATT
CTTGAACCATAAGAGTGGAGATCATATAAAAAGAAATAAAGTTTTAGTGAAGAATTTAGA
TAAATACTCAAATCAATCAAGTTGCATCCAGGAGAATTCAAGCAACATTTATTGGAAAAT
TACAAATTTATCTTGGAAAAAGAAATTATACCTGAGCTCAACAGTAATAAGGTTCCTGCC
TTTTTCAAAAGAGTTGTCTATGTTTTTAGAAAAGTTGAATGA