Identifiers and Description

Gene Model Identifier

TTHERM_00382110

Standard Name

MNP1 (MacroNuclear Protein 1)

Aliases

PreTt10368 | 40.m00253

Description

Myb-like DNA binding domain protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Domains

  • ( PF00249 ) Myb-like DNA-binding domain

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.2%

TetraMine Data

TTHERM_00382110

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_00061.19.997093137033517e-262hypothetical protein (365 aa)
OxytrichaContig22126.0.g422.999534586690157e-23Mur ligase middle domain

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:SUPR000292

Sequences

>TTHERM_00382110(coding)
ATGACTAGCGTTGATAAAGAACTTTAGGAAGTTGACTTTGAGAATACAAGCAAATAACTT
AAAACAATAATACCAACAACTTCAAATATAATTTAGAGCAGCAATAAAGCTGAATTAGAT
GATTTGGAAAACAGGGAGGGCTTAGAGCCAAATTTGATTAAAAAGAGGAAAATAAATGAT
ATATAAAATGATTTGAGGAGTAAAGCATAGAATAGAATTAGAGATATAAATCCAGAAAGT
ATTCTTGAGCACCTAAGAAATATAGCAACTTATGGTGAGAAATGTCAGTTAAACGATGAA
AGCGAAAAAGCCTTAGAATAAATCCTCGAATATAAACAAAATGCTCAAGGCTTAGTCATC
AATGAAGAGCTTTTTTAGGCATCAAAGGAAGGACATGAGCTAACTCCTGCTATTTTCACT
AAAAAAACAAATGTTACTGCTCGCATGAGTAAAAATATGCATACTTGGATGATTGGCTTC
GAAAATTATCTCAGCATGGTGGCTTAATTGTATTATAAAAAGAATTTTAATATCCGCGAA
ATTCTAATGATTCCAGGCGAAAACAGAGACACAGTAGTGCAAAACTCTCTTAATCTCTCT
TCAAATGGTGAAAAAAAGAAGCGAGGACGCAAAAACACTTCCAAAGCATCCACAAATTAA
AAGGAAAACTTCTCTAGCAGCACGAACGATGAATCAAGCAGCAAAAAGCCAGCTTCTGGA
AATCAAAATAATTCAAATCATCATGGGAGAAGAGGGCGCCCTTCTGCAAACCAAGAAGAG
AAGAAGAACGAATAACAACAATATAATTTTTCTAAAGAAGAGATACAATTATCCATCCTT
GACTAGCTAATAAATCCGCTAAAAACTGACTATCCTTTTGAACTCTGGAGCCCTAAAGAA
ATAGCTATCTTTGAGTGCGCTATGTGTAAATTTGGGAAATAATTTGGATTTATCTCTGCA
TTAATAGGAACTAAAACACATAGAGATGTATTCGAGTTTTACTTAATGTGGAAAGGGACA
TCTCATTATAAAATATGGAAAATGCATAAAAATATAGGAAATAGAAATAATCACTCACAT
TTAATTTGA


>TTHERM_00382110(protein)
MTSVDKELQEVDFENTSKQLKTIIPTTSNIIQSSNKAELDDLENREGLEPNLIKKRKIND
IQNDLRSKAQNRIRDINPESILEHLRNIATYGEKCQLNDESEKALEQILEYKQNAQGLVI
NEELFQASKEGHELTPAIFTKKTNVTARMSKNMHTWMIGFENYLSMVAQLYYKKNFNIRE
ILMIPGENRDTVVQNSLNLSSNGEKKKRGRKNTSKASTNQKENFSSSTNDESSSKKPASG
NQNNSNHHGRRGRPSANQEEKKNEQQQYNFSKEEIQLSILDQLINPLKTDYPFELWSPKE
IAIFECAMCKFGKQFGFISALIGTKTHRDVFEFYLMWKGTSHYKIWKMHKNIGNRNNHSH
LI


>TTHERM_00382110(gene)
ATGACTAGCGTTGATAAAGAACTTTAGGAAGTTGACTTTGAGAATACAAGCAAATAACTT
AAAACAATAATACCAACAACTTCAAATATAATTTAGAGCAGCAATAAAGCTGAATTAGAT
GATTTGGAAAACAGGGAGGGCTTAGAGCCAAATTTGATTAAAAAGAGGAAAATAAATGAT
ATATAAAATGATTTGAGGAGTAAAGCATAGAATAGAATTAGAGATATAAATCCAGAAAGT
ATTCTTGAGCACCTAAGAAATATAGCAACTTATGGTGAGAAATGGTATGTTTTTACTGCA
AATTAATTTTTTATCTGCTAAATAAAATAAGCATATTTTGTGTTAAGATCTATTTAAATT
CATTGTCACTATTAACTAAATACTCTTTCATGCTCAAAAATATCCCTTTTTATAATAGTC
AGTTAAACGATGAAAGCGAAAAAGCCTTAGAATAAATCCTCGAATATAAACAAAATGCTC
AAGGCTTAGTCATCAATGAAGAGCTTTTTTAGGCGTAATTTACTTTCTTTGGATATTTAA
AACTGTATTTTCTATTGCTCAACATATATCATAGCTTTTAATCCTATTATTTATTGAAAT
GAATACCATTTTATAATAATTCAAATGCTTTTTCACTCTGCATGAGAGTTTTTTTATACA
AAATTTAGTCATCAAAAACACATTTTAAAAGTTTTAAGATGATGCTTAATAAAATTTTTA
TTTAAATTAACAGATCAAAGGAAGGACATGAGCTAACTCCTGCTATTTTCACTAAAAAAA
CAAATGTTACTGCTCGCATGAGTAAAAATATGCATACTTGGATGATTGGCTTCGAAAATT
ATCTCAGCATGGTGGCTTAATTGTATTATAAAAAGAATTTTAATATCCGCGAAATTCTAA
TGATTCCAGGCGAAAACAGAGACACAGTAGTGCAAAACTCTCTTAATCTCTCTTCAAATG
GTGAAAAAAAGAAGCGAGGACGCAAAAACACTTCCAAAGCATCCACAAATTAAAAGGAAA
ACTTCTCTAGCAGCACGAACGATGAATCAAGCAGCAAAAAGCCAGCTTCTGGAAATCAAA
ATAATTCAAATCATCATGGGAGAAGAGGGCGCCCTTCTGCAAACCAAGAAGAGAAGAAGA
ACGAATAACAACAATATAATTTTTCTAAAGAAGAGATACAATTATCCATCCTTGACTAGC
TAATAAATCCGCTAAAAACTGACTATCCTTTTGGTAATTTTGCTTTTTTATTATTTTATG
GTTCCTATTTGACAAAGCCTTACTCCTTTTATAACTACCTAACCTATTCTACTTATATTT
GTTAAATAAACAAACAAACAATCAATCAAACAAGCTTTCAATCAATCAATCTATATATAT
ATATATTTATTTATTTTGCTATCAATTTTTTCATCGTTTTCTATTTGCATCAAAAATTTT
CAAAATCAAATAGCACTTAATAATAAATTTATAGATTTTCTTAGATAAATATTTTAATAA
GAAGCTATTATGTATATCATCTTAACTTTTACCGCGATTCATTCCTTAATCTGCATATTC
ATAATTACCAAGAATATATTTAACATATTTCTAATCCAAGCTAATTGTAATTCAATGATT
ATTAAATAGCAAATGCCTCATCATTAAAATTTAACTTGAATGTATCTAAAATAATAAATT
AAATCTTTACTTTTTCTATGAAGATACCATTTCTTTCTTTTTCTAATAACCCACTTTGAA
TCTATAAATATTTTATCCTTATTTTTTTTTTGATTTTAAATATGATATTTAAAAAAAGAA
CTCTGGAGCCCTAAAGAAATAGCTATCTTTGAGTGCGCTATGTGTAAATTTGGGAAATAA
TTTGGATTTATCTCTGCATTAGTAAAATTAAATTTAATAGAAAGACTAATTATAATATAT
AAAAATATATTTACTTATTAGATAGGAACTAAAACACATAGAGATGTATTCGAGTTTTAC
TTAATGTGGAAAGGGACATCTCATTATAAAATATGGAAAATGCATAAAAATATAGGAAAT
AGAAATAATCACTCACATTTAATTTGA