Identifiers and Description

Gene Model Identifier

TTHERM_00382290

Standard Name

MNDP1 (Homolog of budding yeast MND1 (meiotic non disjunction)and fission yeast MCP7)

Aliases

PreTt10386 | 40.m00271

Description

In budding yeast, the Mnd1 protein forms a complex with Hop2 to promote homologous chromosome pairing and meiotic DSB repair. Mnd1 requires Hop2 to localize to chromosomes. There exists an ubiquitously expressed paralog, MNDP1.

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Biological Process

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00382290

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_00032.11.9999788875029746e-125Mnd1 family protein (205 aa)
OxytrichaContig15105.0.g323.0013534825799953e-36Mnd1 family
DictyBaseDDB_G02917509.99946582325553e-18mnd1 on chromosome: 6 position
686426 to 687387
SGDYGL183C9.99946582325553e-18MND1 Protein required for reco
mbination and meiotic nuclear
division; forms a complex with
Hop2p, which is involved in c
hromosome pairing and repair o
f meiotic double-strand breaks
Stentor CoeruleusSteCoe_22276.305116760146989e-16

General Information

Paragraph NoGene NameParagraph Text
56MNDP1Hop2 and Mnd1 are meiosis-specific proteins that function in a complex in budding yeast. Their general architecture is strikingly similar, and therefore they are potentially homologous protein families. The Hop2-Mnd1 system seems to have undergone duplication in the evolutionary history of Tetrahymena, because both protein families are represented by two homologs with distinct expression patterns in this species. Just as for HOP2 (meiotic) and HOPP2 (ubiquitous), there is a meiotic (MND1)and a ubiquitously expressed (MNDP1) version, which raises the possibility that a meiotic and a ubiquitous Mnd1p-Hop2p complex exists.

Associated Literature

  1. Ref:18522989: Mochizuki K, Novatchkova M, Loidl J (2008) DNA double-strand breaks, but not crossovers, are required for the reorganization of meiotic nuclei in Tetrahymena. Journal of cell science 121(Pt 13):2148-58

Sequences

>TTHERM_00382290(coding)
ATGGCTAAAAGAACTAAACCTTTAACTCTTGAATAGAAGAGAGAAAAAATGCTCCATGTC
TTCCATGAAACTCAATAAGTTTACAACTTGAAGGAAATTGAAAAATTCTCCACAAAGGCA
GGCATTGTACTTCCTACTGTAAAGGATGTTTTGATGAGTTTGATTGCAGATGGACTTGTT
GATTCTGATAAAATTGGTTCTGCTAACTTTTACTGGTCTCTCCCTTCACAAACTTACTTG
ATTTTAAAATTAAGATTAGCTGAAGCAGAACAAAAAATGAAAGATTGCGATTAAAAAAAG
GTAGAATTAGAGGATGAGCTAGAGAAATCCGTTATAGATAAAGAACCAAGCGATGATCGA
ACAGAATAGCTGAACAAATTAAAGGAATTGTAAGAAACTTTAAAGAAGAAGGAAAAGGAT
TTAGAAAAATACAAGAAATACGATCCTGAAAGACTAAAACAACTAGAGGAGTAAACTGAA
GATCTTAAAGCTAAGGTTAATCTGTGGACTGATAACTTATTCTCTTTAAAATCTTACATA
TAAAAATTAACTCCTATGGATGATGAAGAAGTTGAAAAAGCCTTCTCTATTCCAGCTGAT
CTCGATAATGTATGA


>TTHERM_00382290(protein)
MAKRTKPLTLEQKREKMLHVFHETQQVYNLKEIEKFSTKAGIVLPTVKDVLMSLIADGLV
DSDKIGSANFYWSLPSQTYLILKLRLAEAEQKMKDCDQKKVELEDELEKSVIDKEPSDDR
TEQLNKLKELQETLKKKEKDLEKYKKYDPERLKQLEEQTEDLKAKVNLWTDNLFSLKSYI
QKLTPMDDEEVEKAFSIPADLDNV


>TTHERM_00382290(gene)
ATGGCTAAAAGAACTAAACCTTTAACTCTTGAATAGAAGAGAGAAAAAATGCTCCATGTC
TTCCATGAAACTGTAACTAATACAAGATTTTTTTTAATAACTATGGTTTTTATATATAAA
ATGCCTAATTGTGTAGCAAGAAATATTAATGATTTTTTTTTTAAAGCAATAAGTTTACAA
CTTGAAGGAAATTGAAAAATTCTCCACAAAGGCAGGCATTGGTAATAAATAATAACAATA
AGCTTTTTTATTCAAATACTTAAACAAGCATGATGCTATAATTAAATATAATTTTTATTA
GTACTTCCTACTGTAAAGGATGTTTTGATGAGTTTGATTGCAGATGGACTTGTTGATTCT
GATAAAATTGGTTCTGCTAACTTTTACTGGTCTCTCCCTTCACAAACTTACTTGATTGTA
AACTAAATAAATTTACTTTGAAATATTTAAAAGCAATAGTTAAAAGTAGAATTCTTTGAA
TAGCCATTTTTATATAATAGTTAAAATTAAGATTAGCTGAAGCAGAACAAAAAATGAAAG
ATTGCGATTAAAAAAAGGTAGAATTAGAGGATGAGCTAGAGAAATCCGTTATAGATAAAG
AACCAAGCGTAAATAAAATTTAATAATGATAAAGTTTAATTAATGTATTAAATTAATTAG
GATGATCGAACAGAATAGCTGAACAAATTAAAGGAATTGTAAGAAACTTTAAAGAAGAAG
GAAAAGGATTTAGAAAAATACAAGAAATACGATCCTGAAAGACTAAAACAACTAGGTAAA
TAATATGAAATAAAATATATAAAATAATGTTAATCATATATATAAATATAAAGAGGAGTA
AACTGAAGATCTTAAAGCTAAGGTTAATCTGTGGACTGATAACTTATTCTCTTTAAAATC
TTACATATAAAAATTAACTCCTATGGATGATGAAGAAGTTGAAAAAGCCTTCTCTATTCC
AGCTGATCTCGATAATGTATGA