Identifiers and Description

Gene Model Identifier

TTHERM_00300660

Standard Name

MND1 (Homolog of budding yeast MND1 (meiotic non disjunction)and fission yeast MCP7)

Aliases

PreTt19361 | 28.m00320 | 3691.m00138

Description

In budding yeast, the Mnd1 protein forms a complex with Hop2 to promote homologous chromosome pairing and meiotic DSB repair. Mnd1 requires Hop2 to localize to chromosomes.

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF03962 ) Mnd1 family
  • ( PF05316 ) Mitochondrial ribosomal protein (VAR1)

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 9.1%

TetraMine Data

TTHERM_00300660

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_07698.16.000667945664035e-116hypothetical protein (717 aa)
OxytrichaContig17386.0.g510.000009999254677478949hypothetical protein

General Information

Paragraph NoGene NameParagraph Text
57MND1Hop2 and Mnd1 are meiosis-specific proteins that function in a complex in budding yeast. Their general architecture is strikingly similar, and therefore they are potentially homologous protein families. The Hop2-Mnd1 system seems to have undergone duplication in the evolutionary history of Tetrahymena, because both protein families are represented by two homologs with distinct expression patterns in this species. Just as for HOP2 (meiotic) and HOPP2 (ubiquitous), there is a meiotic (MND1)and a ubiquitously expressed (MNDP1) version, which raises the possibility that a meiotic and a ubiquitous Mnd1p-Hop2p complex exists.

Associated Literature

  1. Ref:18522989: Mochizuki K, Novatchkova M, Loidl J (2008) DNA double-strand breaks, but not crossovers, are required for the reorganization of meiotic nuclei in Tetrahymena. Journal of cell science 121(Pt 13):2148-58

Sequences

>TTHERM_00300660(coding)
ATGGGAAAAAGATTGGATAGATTTTTAAATTTTATAAAATAGATTGATAAAATAGATATT
TATGGCTAGAAGATTAGCCTCAAATTCATGAAAGAGTCTGAATATAAAACAAGGTTTGGA
GGCTTAATAACTTTAGTAGTTGGGTTATTGACTGGACTTTGGACCTTAGTTTCAATTTAT
CAGTTAATATATTCTTCTGTTAATTCAATCATATCTCAAGAATATGTAATGGATGCTTAA
GAATTAAATTCAATATCTTTTAATCCTAAGTCTTAAAATACATTTTAGGTAGGGTTTTTC
AATAAATAAACTCAATTGCCAATTGATTAGAATTATTTTAAAATAGTTTCATATTATAAT
TAAGAATGTGATATCATTAATTAAAAAGTAGAAGTATTATCTTTTTAGGAAATTCAAAGT
AAATCAGTGGAACTAACTGATTGCTAAGATCTTATAGAATCATCTTAAGAATATCAGTTT
TTAAGTTAAACAAAAGATGGGTATTTTTGCTTCAACAAAGACAAATCATTTACAGAAAAT
GAAGTTTATCCTGAAATTTAATAAACAGTTAACTGTCGTAATAGTATTAATATTTTGGTA
ACAAAGAGTAAAGATTTAGATGACTAAATTTTGTAAAACTTAAAGTAAAACAGTACTTTA
AGCTTGTCTGTTCCTACAACGTTAGTTGACTATACAGACATCCAAAATCCTTTCGATTAC
ACAAATATTATGAAACAATTTGACACAAATTTGTTTTTTAGTACTTAATCTAATATTTAA
TAAAAATTAATGATTTAAATAAATTTCTAAGCATTAATAATAGAAGATGAAAGAAATTAT
TCAATTCAATAAAATAGACTGATGAAATCTTTCGCAATATAATCAATTTCAGATAAACTT
ATCAATAGTGCTCTTAATCCTTAGGAGTAATCTTAGCTTAAAAATACCATTAACGATTCT
GATGTCTTATTCAAAATTAAGATTAGTTTTTCTGAATAAAACTACAATAAAAAATATATT
AGATCGTTTTAAAGCATACCTTCCATTCTAGGTAGTCTAGGAGGTGGTATTAAAATAGTA
GTTCTTATGGGATTTCTTATAGTTAGTCCTCTGTGCCAGATTCATTTTTAAAAGACTATG
CTAAATGAGGTGTTTAATTTTGAAAATGACTAAGATGATGATGATGATGAAAATTACTAA
AATAACTTTAATCTTCAGTCACTAAAATCTTTAGATGGGATATAAACAAATAACAAAAAT
CATATAAGTATTAATAACAACAGCAATATTTCTTAAGCCTAGAATTAAGATAATCCCAAA
AAATAGCAAGTCTCTAAAGGTTTATAGAAGATTAACAACTTTGAAAACTAATAAAATATA
TTGCAAACTAGTTCTCCAAAATATATTTAGGCTCTCAAAAATGTCACTAGTTTTATTTAA
ATTCAAAATATTAACTAAAAGTAAGAAAACTTACCCACTTCTACTAAAAGTATTACAAAT
TTTAAACAAATTAAAAATATAGAAAAGCCAATATAAAAACAAATCAATTAAATAACTAAT
AATTACACACATTAAAATAGCATGATATTTTCAAAGCATTCTCTTTAACAAGAAAACAAT
AATGATGAACTAAATTTTACGTAGCTAAGCTAACTGAAAGGTGGAGAAAGGAAAAACAAA
ATGAAAGAAATAATAAAGGGAACTATTTTTATCAATTCTTAAAGATAAATAGACTCTTAA
CAGTGTATAGATCAAAATTCCCCACTCCCTAAATTTCCTTAAAGATTATCATTTCTATCA
AACGCTTAATCATAGAAAACTATTGCCTTAACCAAAAAGAAATAAAATGACCAAAAGAAA
GCTGAAGAATAAATATTTGAAAAATATTTCAAGACAACATTCAATCCTCTAAAAATATCT
TTTATCGAAAGTTTATTTTACTATATATGGCCTTTCGGTAAATTCAAAAGAACCAAGGAA
CAGATGAGCTATTCTATTGATAAGCTAAATTACCATTTAGATAGTATTTACATCATTAAA
AAGCTACTTGAGATTGATAAGCTTAAAATGCTTTTATTAGATGAAAATTAAATTAAATTA
CTAGAATTCCTTCCAAAACCAACAATAAATTTGAAAAAAGTAGTAAACTAATAAGAATCT
TTTTAGGTTAGCTCTAATTTAATAACTGAAGATGATTAAAAAAAGATAAATATTTTGTAT
TAAGATACCAGAAATGAGTTAACAAAAGCTACACAAGCATTCTAAGCTTTCTAATCAATA
AAAGCCAAATCATCATTAACATAAATCGATAGAAAATTAATAGATTTACTGGATCCTAAA
ATTGCAGATTATTTTAATTAAGACAGTGATGATAATAAATCTTAAATAATTTAGTTAAAC
TAAATGAGTTTAGAAAACGAAAATAATCAACTTAATATCAATTATGATAAGGATACATCA
AATAAAATTTAACTTAATTATCAGTAAGAAAATACTACTCCTTAATCTTAGAATCTGATA
AAAGAAATTTACTAAAAAAGCAAAGGAAGCAGCGGTTATATTAGTTCTCCCTTGGAGATA
TACAGAAGTACAGCTAAGAAAGCATCTATGTTTAAATAACCACATATAAAGAGAGGATCT
CTTCATGTAACTTCTCAATATAATAGATAAGACGAAGTAGAAGAATATCAAAAAAATAAT
TAAATTTAGATAAAATATATACAAAATGATGGTTAAAGTGATTAGCATATACCTACAAGA
CTTACTCGCTTAAAATCATACTCAAGTGAAGATATTAATAAAATGCAAAGGCGAAGCAAG
GAAAGCTCGGTATCTAGCTAATAAAGTAAAGAAGGATCTAGCTTTTATTTTGGAGTTAAG
AATATTTCAGCACAATACCCTAAATCACTAGAAATGTAATATGTACTAGACGATTCTCAT
TTGTAGTAAGATGTAATTAATGGAGATATGGAAGAATCTCAGTAAAAATAACAATAAAAT
TAAAAAATATCTTTGGAGTTGAACAATGAAATAAATCATAGCAACCCTCCTGGATTGAAA
AAAATCTTCTCAAGCTCCCTAATCAGTAGTTGTAGTCATAGCATTATTGCAGATGAATCA
ATAAAACTCTAAAGTATAGATTGCCAAAATTTATAAATGTTTACAAAATAAAATAAATTT
TGTAAGTCTTCAAATTTGATAGTATCATAAAATTAGAAATAAGCAGAAAATTAGTCTGAA
TAAATTAATACCAGCAGTGAATAGACATATTTTAGAGAGAAAAAAAATTCTTCAAATGAA
GAAAATAAATTAGTTTCCCAATATGAAATTCAAATAAATTTACATAAAAAAGTTTAAAGT
TAAGAAAATATGAGTTGA


>TTHERM_00300660(protein)
MGKRLDRFLNFIKQIDKIDIYGQKISLKFMKESEYKTRFGGLITLVVGLLTGLWTLVSIY
QLIYSSVNSIISQEYVMDAQELNSISFNPKSQNTFQVGFFNKQTQLPIDQNYFKIVSYYN
QECDIINQKVEVLSFQEIQSKSVELTDCQDLIESSQEYQFLSQTKDGYFCFNKDKSFTEN
EVYPEIQQTVNCRNSINILVTKSKDLDDQILQNLKQNSTLSLSVPTTLVDYTDIQNPFDY
TNIMKQFDTNLFFSTQSNIQQKLMIQINFQALIIEDERNYSIQQNRLMKSFAIQSISDKL
INSALNPQEQSQLKNTINDSDVLFKIKISFSEQNYNKKYIRSFQSIPSILGSLGGGIKIV
VLMGFLIVSPLCQIHFQKTMLNEVFNFENDQDDDDDENYQNNFNLQSLKSLDGIQTNNKN
HISINNNSNISQAQNQDNPKKQQVSKGLQKINNFENQQNILQTSSPKYIQALKNVTSFIQ
IQNINQKQENLPTSTKSITNFKQIKNIEKPIQKQINQITNNYTHQNSMIFSKHSLQQENN
NDELNFTQLSQLKGGERKNKMKEIIKGTIFINSQRQIDSQQCIDQNSPLPKFPQRLSFLS
NAQSQKTIALTKKKQNDQKKAEEQIFEKYFKTTFNPLKISFIESLFYYIWPFGKFKRTKE
QMSYSIDKLNYHLDSIYIIKKLLEIDKLKMLLLDENQIKLLEFLPKPTINLKKVVNQQES
FQVSSNLITEDDQKKINILYQDTRNELTKATQAFQAFQSIKAKSSLTQIDRKLIDLLDPK
IADYFNQDSDDNKSQIIQLNQMSLENENNQLNINYDKDTSNKIQLNYQQENTTPQSQNLI
KEIYQKSKGSSGYISSPLEIYRSTAKKASMFKQPHIKRGSLHVTSQYNRQDEVEEYQKNN
QIQIKYIQNDGQSDQHIPTRLTRLKSYSSEDINKMQRRSKESSVSSQQSKEGSSFYFGVK
NISAQYPKSLEMQYVLDDSHLQQDVINGDMEESQQKQQQNQKISLELNNEINHSNPPGLK
KIFSSSLISSCSHSIIADESIKLQSIDCQNLQMFTKQNKFCKSSNLIVSQNQKQAENQSE
QINTSSEQTYFREKKNSSNEENKLVSQYEIQINLHKKVQSQENMS


>TTHERM_00300660(gene)
ATGGGAAAAAGATTGGATAGATTTTTAAATTTTATAAAATAGATTGATAAAATAGATATT
TATGGCTAGAAGATTAGCCTCAAATTCATGAAAGAGTCTGAATATAAAACAAGGTTTGGA
GGCTTAATAACTTTAGTAGTTGGGTTATTGACTGGACTTTGGACCTTAGTTTCAATTTAT
CAGTTAATATATTCTTCTGTTAATTCAATCATATCTCAAGAATATGTAATGGATGCTTAA
GAATTAAATTCAATATCTTTTAATCCTAAGTCTTAAAATACATTTTAGGTAGGGTTTTTC
AATAAATAAACTCAATTGCCAATTGATTAGAATTATTTTAAAATAGTTTCATATTATAAT
TAAGAATGTGATATCATTAATTAAAAAGTAGAAGTATTATCTTTTTAGGAAATTCAAAGT
AAATCAGTGGAACTAACTGATTGCTAAGATCTTATAGAATCATCTTAAGAATATCAGTTT
TTAAGTTAAACAAAAGATGGGTATTTTTGCTTCAACAAAGACAAATCATTTACAGAAAAT
GAAGTTTATCCTGAAATTTAATAAACAGTTAACTGTCGTAATAGTATTAATATTTTGGTA
ACAAAGAGTAAAGATTTAGATGACTAAATTTTGTAAAACTTAAAGTAAAACAGTACTTTA
AGCTTGTCTGTTCCTACAACGTTAGTTGACTATACAGACATCCAAAATCCTTTCGATTAC
ACAAATATTATGAAACAATTTGACACAAATTTGTTTTTTAGTACTTAATCTAATATTTAA
TAAAAATTAATGATTTAAATAAATTTCTAAGCATTAATAATAGAAGATGAAAGAAATTAT
TCAATTCAATAAAATAGACTGATGAAATCTTTCGCAATATAATCAATTTCAGATAAAGTA
AATTATTTTGTTTAAAATATTATTAAATTTTAATAATAATAATAATTATAATAAAGCTTA
TCAATAGTGCTCTTAATCCTTAGGAGTAATCTTAGCTTAAAAATACCATTAACGATTCTG
ATGTCTTATTCAAAATTAAGATTAGTTTTTCTGAATAAAACTACAATAAAAAATATATTA
GATCGTTTTAAAGCATACCTTCCATTCTAGGTAGTCTAGGAGGTGGTATTAAAATAGTAG
TTCTTATGGGATTTCTTATAGTTAGTCCTCTGTGCCAGATTCATTTTTAAAAGACTATGC
TAAATGAGGTGTTTAATTTTGAAAATGACTAAGATGATGATGATGATGAAAATTACTAAA
ATAACTTTAATCTTCAGTCACTAAAATCTTTAGATGGGATATAAACAAATAACAAAAATC
ATATAAGTATTAATAACAACAGCAATATTTCTTAAGCCTAGAATTAAGATAATCCCAAAA
AATAGCAAGTCTCTAAAGGTTTATAGAAGATTAACAACTTTGAAAACTAATAAAATATAT
TGCAAACTAGTTCTCCAAAATATATTTAGGCTCTCAAAAATGTCACTAGTTTTATTTAAA
TTCAAAATATTAACTAAAAGTAAGAAAACTTACCCACTTCTACTAAAAGTATTACAAATT
TTAAACAAATTAAAAATATAGAAAAGCCAATATAAAAACAAATCAATTAAATAACTAATA
ATTACACACATTAAAATAGCATGATATTTTCAAAGCATTCTCTTTAACAAGAAAACAATA
ATGATGAACTAAATTTTACGTAGCTAAGCTAACTGAAAGGTGGAGAAAGGAAAAACAAAA
TGAAAGAAATAATAAAGGGAACTATTTTTATCAATTCTTAAAGATAAATAGACTCTTAAC
AGTGTATAGATCAAAATTCCCCACTCCCTAAATTTCCTTAAAGATTATCATTTCTATCAA
ACGCTTAATCATAGAAAACTATTGCCTTAACCAAAAAGAAATAAAATGACCAAAAGAAAG
CTGAAGAATAAATATTTGAAAAATATTTCAAGACAACATTCAATCCTCTAAAAATATCTT
TTATCGAAAGTTTATTTTACTATATATGGCCTTTCGGTAAATTCAAAAGAACCAAGGAAC
AGATGAGCTATTCTATTGATAAGCTAAATTACCATTTAGATAGTATTTACATCATTAAAA
AGCTACTTGAGATTGATAAGCTTAAAATGCTTTTATTAGATGAAAATTAAATTAAATTAC
TAGAATTCCTTCCAAAACCAACAATAAATTTGAAAAAAGTAGTAAACTAATAAGAATCTT
TTTAGGTTAGCTCTAATTTAATAACTGAAGATGATTAAAAAAAGATAAATATTTTGTATT
AAGATACCAGAAATGAGTTAACAAAAGCTACACAAGCATTCTAAGCTTTCTAATCAATAA
AAGCCAAATCATCATTAACATAAATCGATAGAAAATTAATAGATTTACTGGATCCTAAAA
TTGCAGATTATTTTAATTAAGACAGTGATGATAATAAATCTTAAATAATTTAGTTAAACT
AAATGAGTTTAGAAAACGAAAATAATCAACTTAATATCAATTATGATAAGGATACATCAA
ATAAAATTTAACTTAATTATCAGTAAGAAAATACTACTCCTTAATCTTAGAATCTGATAA
AAGAAATTTACTAAAAAAGCAAAGGAAGCAGCGGTTATATTAGTTCTCCCTTGGAGATAT
ACAGAAGTACAGCTAAGAAAGCATCTATGTTTAAATAACCACATATAAAGAGAGGATCTC
TTCATGTAACTTCTCAATATAATAGATAAGACGAAGTAGAAGAATATCAAAAAAATAATT
AAATTTAGATAAAATATATACAAAATGATGGTTAAAGTGATTAGCATATACCTACAAGAC
TTACTCGCTTAAAATCATACTCAAGTGAAGATATTAATAAAATGCAAAGGCGAAGCAAGG
AAAGCTCGGTATCTAGCTAATAAAGTAAAGAAGGATCTAGCTTTTATTTTGGAGTTAAGA
ATATTTCAGCACAATACCCTAAATCACTAGAAATGTAATATGTACTAGACGATTCTCATT
TGTAGTAAGATGTAATTAATGGAGATATGGAAGAATCTCAGTAAAAATAACAATAAAATT
AAAAAATATCTTTGGAGTTGAACAATGAAATAAATCATAGCAACCCTCCTGGATTGAAAA
AAATCTTCTCAAGCTCCCTAATCAGTAGTTGTAGTCATAGCATTATTGCAGATGAATCAA
TAAAACTCTAAAGTATAGATTGCCAAAATTTATAAATGTTTACAAAATAAAATAAATTTT
GTAAGTCTTCAAATTTGATAGTATCATAAAATTAGAAATAAGCAGAAAATTAGTCTGAAT
AAATTAATACCAGCAGTGAATAGACATATTTTAGAGAGAAAAAAAATTCTTCAAATGAAG
AAAATAAATTAGTTTCCCAATATGAAATTCAAATAAATTTACATAAAAAAGTTTAAAGTT
AAGAAAATATGAGTTGA