Identifiers and Description

Gene Model Identifier

TTHERM_00194130

Standard Name

MMS4 (Homolog of budding yeast MMS4 and fission yeast EME1)

Aliases

PreTt06697 | 16.m00353

Description

The homologous yeast proteins form a complex with Mus81 and have a role in the resolution of DNA joint molecules.

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( TIGR00288 ) conserved hypothetical protein TIGR00288

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.3%

TetraMine Data

TTHERM_00194130

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_03681.11.999658401959794e-176hypothetical protein (405 aa)
DictyBaseDDB_G02841390.00000019998969434520019DDB_G0284139 on chromosome: 4
position 1640056 to 1641798

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00194130(coding)
ATGAGGATATAAGTTACTAAAGGTAAAATTGAAGATGCTCTTCTGATTTTTGGTAAAGAT
TACTCTGAAATCGAAGAAATAGAAGAATTTTTGACAAATTGTGAATGTTCTTCTTTTTAG
TTGGAAGTTTAACAAACTCTTGAGTAGAATCAAATTTAGATTTACACTGTTGATCGCAAA
AAAGAATCTAAGAAACCGAAAAAAAAAACATTTAAAAATAAAGATTTTAATGTTTATGAT
ATTGTAACCAAATATAATTAAAACTTTTCTATAGAAGGAGAGTTGTCTGATGACAACCAT
CTAGAAGATGGTTAAGTAAATAGCAATAAATATGGAGAAATAATTGATAAGTAAATACAA
GCTAATTTATTTTACTTTAACAGATAAATGTTCAATATGTTCTCGAATTTAGATGAAATT
ACACAGTTCATTTTAAATAAAAAAGTGCAAGGCACTAAAAATGTATTAGTTTTAGAAGAT
ATAAAAGATATATTTGTTTCAAGATAGATAAGAAAAGAGATATAAATGACTTAAAATGCT
CCTAAAAGAAATCTAAGTTCAGATGAAGGAGAATAAGGGTTGGACTTTGAAGATTTATTT
TAAAAAAGAGATTAAAATAAAAGTATTAAGGAAAAAAAAACTGGTTTTTCAACAAGTGAT
GATGAAAATGCTCCTCAATATTAAGGTAATAAATTCTGCAGTTAATAAAACAAAAAGAAA
TCTATTCAGGGTAGTGATGCTGCTATATAAGATTGGCTGTGCGAAATAGGTATAAAATAC
GATATTGACTATAGATTCACATTCAGTCCAAAAGAAACGAATGAATATTTGACTAATTGT
TTACTGACAGCAATAAAATCAAAATATAAAAAAGATATTGGTTTGTTTGATCAAAAGAAT
AAAACTACTTCTGAATTAGCTACAGCCGAAGGACTAACGGGATACTACGATTAGTAATGG
GTATAAATTTTAATGTCAATAAATCAAATCAGTGAAAAGAAAGCAGTGGCAGTTGCCAAA
GAATACAGAACTATAACTTAACTTATTAAAATATACAAATAATAAGAAAGCTTAAAATAA
AGAGAATTAGCTTTGCAATCTATACAATATAAAGGAGAAAAAGGTAAAAGTGAAAAAAGT
TTAGGAAAAGTTATTTCTAAAAAAATATTTAATATATTTTCTAACGACGATCCAAATGAT
CTTATAAATTAATGA


>TTHERM_00194130(protein)
MRIQVTKGKIEDALLIFGKDYSEIEEIEEFLTNCECSSFQLEVQQTLEQNQIQIYTVDRK
KESKKPKKKTFKNKDFNVYDIVTKYNQNFSIEGELSDDNHLEDGQVNSNKYGEIIDKQIQ
ANLFYFNRQMFNMFSNLDEITQFILNKKVQGTKNVLVLEDIKDIFVSRQIRKEIQMTQNA
PKRNLSSDEGEQGLDFEDLFQKRDQNKSIKEKKTGFSTSDDENAPQYQGNKFCSQQNKKK
SIQGSDAAIQDWLCEIGIKYDIDYRFTFSPKETNEYLTNCLLTAIKSKYKKDIGLFDQKN
KTTSELATAEGLTGYYDQQWVQILMSINQISEKKAVAVAKEYRTITQLIKIYKQQESLKQ
RELALQSIQYKGEKGKSEKSLGKVISKKIFNIFSNDDPNDLINQ


>TTHERM_00194130(gene)
ATGAGGATATAAGTTACTAAAGGTAAAATTGAAGATGCTCTTCTGATTTTTGGTAAAGAT
TACTCTGAAATCGAAGAAATAGAAGAATTTTTGACAAATTGTGAATGTTCTTCTTTTTAG
TTGGAAGTTTAACAAACTCTTGAGTAGAATCAAATTTAGATTTACACTGTTGATCGCAAA
AAAGAATCTAAGAAACCGAAAAAAAAAACATTTAAAAATAAAGATTTTAATGTTTATGAT
ATTGTAACCAAATATAATTAAAACTTTTCTATAGAAGGAGAGTTGTCTGATGACAACCAT
CTAGAAGATGGTTAAGTAAATAGCAATAAATATGGAGAAATAATTGATAAGTAAATACAA
GCTAATTTATTTTACTTTAACAGATAAATGTTCAATATGTTCTCGAATTTAGATGAAATT
ACACAGTTCATTTTAAATAAAAAAGTGCAAGGCACTAAAAATGTATTAGTTTTAGAAGAT
ATAAAAGATATATTTGTTTCAAGATAGATAAGAAAAGAGATATAAATGACTTAAAATGCT
CCTAAAAGAAATCTAAGTTCAGATGAAGGAGAATAAGGGTTGGACTTTGAAGATTTATTT
TAAAAAAGAGATTAAAATAAAAGTATTAAGGAAAAAAAAACTGGTTTTTCAACAAGTGAT
GATGAAAATGCTCCTCAATATTAAGGTAATAAATTCTGCAGTTAATAAAACAAAAAGAAA
TCTATTCAGGGTAGTGATGCTGCTATATAAGATTGGCTGTGCGAAATAGGTATAAAATAC
GATATTGACTATAGATTCACATTCAGTCCAAAAGAAACGAATGAATATTTGACTAATTGT
TTACTGACAGCAATAAAATCAAAATATAAAAAAGATATTGGTTTGTTTGATCAAAAGAAT
AAAACTACTTCTGAATTAGCTACAGCCGAAGGTAAATCAATATATCATATAAAAATTTCT
ACATTTATCTATTATACATACAAATATAGGACTAACGGGATACTACGATTAGTAATGGGT
ATAAATTTTAATGTCAATAAATCAAATCAGTGAAAAGAAAGCAGTGGCAGTTGCCAAAGA
ATACAGAACTATAACTTAACTTATTAAAATATACAAATAATAAGGTAAAAATTAAATTAA
TTTTAGTTTATTCTTATTATGAATTAATTATATTTATTAAAATTATAGAAAGCTTAAAAT
AAAGAGAATTAGCTTTGCAATCTATACAATATAAAGGAGAAAAAGGTAAAAGTGAAAAAA
GTTTAGGAAAAGTTATTTCTAAAAAAATATTTAATATATTTTCTAACGACGATCCAAATG
ATCTTATAAATTAATGA