Identifiers and Description

Gene Model Identifier

TTHERM_00384860

Standard Name

MLP1 (Macronuclear LA-domain protein 1)

Aliases

PreTt24778 | 41.m00185

Description

La domain containing protein localized to macronuclei

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF05383 ) La domain
  • ( PF03413 ) Peptidase propeptide and YPEB domain

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 9.8%

TetraMine Data

TTHERM_00384860

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_04405.19.997093137033517e-262La domain-containing protein (
342 aa)
OxytrichaContig20424.0.g762.9997246065828143e-59Protein of unknown function (D
UF3223)
Stentor CoeruleusSteCoe_52401.4251640827409352e-21
DictyBaseDDB_G02817630.00003998524687536623DDB_G0281763 on chromosome: 3
position 4927454 to 4928627
WormBaseWBGene000200970.0002999184360822198locus:larp-1 status:Partiall
y_confirmed UniProt:H2KZ23
protein_id:CCD65882.1

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:28106166: Arthur LL, Chung JJ, Jankirama P, Keefer KM, Kolotilin I, Pavlovic-Djuranovic S, Chalker DL, Grbic V, Green R, Menassa R, True HL, Skeath JB, Djuranovic S (2017) Rapid generation of hypomorphic mutations. Nature communications 8( ):14112

Sequences

>TTHERM_00384860(coding)
ATGAGCATTAATAAAGAAGAAGTTAAGAAGCAAGTTGAATACTACTTGTCAGATAAGAAC
CTTGTTAACGATGAAAAATTCAGAACCATTATTTAGGAACATCCTGAAGGTTATTTAAGC
TTTGGTAACATCTTGAACTGCAACAAGATAAAGAGACTCGGAGTTACTACTTTTGAATAA
TTAGCTACCTCTCTCGCTGATTCTACTCTCGTTGAACTTAATGAGGCTAAAGATTCAGTC
CGTAGAGCTGGAAACAAACCCATCCCTGCAAAGGAAGCTGTAGATCCTGCTGAAGCTGCT
GAAAAGGAAGCTAGAGAAGCTGAAAAGAAAGAATTAATCAATTTCTACGAAACATTCCAA
CCAATCATTTTCTCAACTGCTTGCGAACAAGAAGGTGTTGCTAATTGGAGAAACATCACC
GAAGCTTTATTAAAGTAACACAACGTCCATGCCCCTTACTGCCGTTTCGGTAAATTAGAA
GGTAACTTCGCCCTCAATAAGGATAAGACCTCCCAAGAAGTTATTGATCAACTTGTCTAA
GATGGTTTACAATTCGGTGAATCTAAAGTTACTATCAAGGTTAGTGAAGGTGAAGCCCTT
AGCAAATTCTGGGAATTACACGGTCGTCACTACAACGGTGTAATGGAATTAAAGAAAAAG
GAAGTTAACCAAACAGTAAAAGCCAAAAAGGACAAAAAGGAAAAGAAATAAAAAAGAGAA
TTTGAATTCGGTGGTGAAAAATACACTGATGTCCTCACCATTAAGAACTTATTCAAGGGA
ATTTTAGGAAGAACTGCAAATGGGTAGAAAATTATCTCCCCTTATCACGAAATGTTAAAA
TCATTGCTTGAATATCATAATAACAAGGAAGCTAAATTAAAAGATTTAGATCACTTCACT
GTTGATGTTCACCCTGAACATAAGGACACTAGATGCTTCTTTGTTGTTAAGTCTGATGGA
ACAAAAGAAGACTTCTCTGCTGTTAAGTGTATTAGCAACTTCGAAGAAAAATTAAAATTG
TGA


>TTHERM_00384860(protein)
MSINKEEVKKQVEYYLSDKNLVNDEKFRTIIQEHPEGYLSFGNILNCNKIKRLGVTTFEQ
LATSLADSTLVELNEAKDSVRRAGNKPIPAKEAVDPAEAAEKEAREAEKKELINFYETFQ
PIIFSTACEQEGVANWRNITEALLKQHNVHAPYCRFGKLEGNFALNKDKTSQEVIDQLVQ
DGLQFGESKVTIKVSEGEALSKFWELHGRHYNGVMELKKKEVNQTVKAKKDKKEKKQKRE
FEFGGEKYTDVLTIKNLFKGILGRTANGQKIISPYHEMLKSLLEYHNNKEAKLKDLDHFT
VDVHPEHKDTRCFFVVKSDGTKEDFSAVKCISNFEEKLKL


>TTHERM_00384860(gene)
ATGAGCATTAATAAAGAAGAAGTTAAGAAGCAAGTTGAATACTACTTGTCAGATAAGAAC
CTTGTTAACGATGAAAAATTCAGAACCATTATTTAGGAACATCCTGAAGTAATAAATAAT
ATCCATTACTTTTCTTCTAGATGTCAAAACAATTATTTTAGATGAAGCAATTTCTACTTA
TTCTTTCCTTATTTAGAATTTTACATAAAATGAAAAAAAGATAATAATGGTATTGATTTA
TTTCTTTATATTTTAATAGGGTTATTTAAGCTTTGGTAACATCTTGAACTGCAACAAGAT
AAAGAGACTCGGAGTTACTACTTTTGAATAATTAGCTACCTCTCTCGCTGATTCTACTCT
CGTTGAACTTAATGAGGCTAAAGATTCAGTCCGTAGAGCTGGAAACAAACCCATCCCTGC
AAAGGAAGCTGTAGATCCTGCTGAAGCTGCTGAAAAGGAAGCTAGAGAAGCTGAAAAGAA
AGAATTAATCAATTTCTACGAAACATTCCAACCGTATTTTATTCATATATCCATATAAAT
AAAGCATTATTAACTTTTTTTGATTATTAGAATCATTTTCTCAACTGCTTGCGAACAAGA
AGGTGTTGCTAATTGGAGAAACATCACCGAAGCTTTATTAAAGTAACACAACGTCCATGC
CCCTTACTGCCGTTTCGGTAAATTAGAAGGTAACTTCGCCCTCAATAAGGATAAGACCTC
CCAAGAAGTTATTGATCAAGTAAAAATTTGATAGAAACAATTTGTTATAATTCTAAGCAT
TTTATTTTAACATAATAAATATTTAGCTTGTCTAAGATGGTTTACAATTCGGTGAATCTA
AAGTTACTATCAAGGTTAGTGAAGGTGAAGCCCTTAGCAAATTCTGGGAATTACACGGTC
GTCACTACAACGGTGTAATGGAATTAAAGAGTAAATAAAGAAATAAATTAAAATCAAGTA
GTTAAAAAAAAAAATTTAAAAATAGAAAAGGAAGTTAACCAAACAGTAAAAGCCAAAAAG
GACAAAAAGGAAAAGAAATAAAAAAGAGAATTTGAATTCGGTGGTGAAAAATACACTGAT
GTCCTCACCATTAAGAACTTATTCAAGGGAATTTTAGGAAGAACTGCAAATGGGTAGAAA
ATTATCTCCCCTTATCACGAAATGGTAAATAAATAAATACGATTTTATTCATAGTCATAT
AAAAATTTTATAATTTTAAATAGTTAAAATCATTGCTTGAATATCATAATAACAAGGAAG
CTAAATTAAAAGATTTAGATCACTTCACTGTTGATGTTCACCCTGAACATAAGGACACTA
GATGCTTCTTTGTTGTTAAGTCTGATGGAACAAAAGAAGACTTCTCTGCTGTTAAGTGTA
TTAGCAACTTCGAAGAAAAATTAAAATTGTGA