Identifiers and Description

Gene Model Identifier

TTHERM_01309130

Standard Name

MLL1 (Mixed lineage leukemia 1)

Aliases

PreTt09136 | 319.m00018

Description

MLL1 SET domain protein; SET domain containing protein; homolog to MLL proteins in mammals- Trithorax in Drosophila- and SET1 in yeasts.

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.2%

TetraMine Data

TTHERM_01309130

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_20980.19.997093137033517e-262SET domain-containing protein
(2325 aa)
OxytrichaContig20462.0.g587.002264059090237e-38PHD-finger
DictyBaseDDB_G02892579.99648502569394e-38set1 on chromosome: 5 position
2551579 to 2556233
WormBaseWBGene000047823.000842737734004e-34locus:set-2 Probable histone
-lysine N-methyltransferase se
t-2 status:Partially_confirm
ed UniProt:Q18221 protein_
id:CCD65735.1
SGDYHR119W1.000137892321693e-31SET1 Histone methyltransferase
, subunit of the COMPASS (Set1
C) complex; COMPASS methylates
histone H3K4; Set1p-dependent
H3K4 trimethylation recruits
Nrd1p, allowing efficient term
ination of snoRNAs and cryptic
unstable transcripts (CUTs) b
y Nrd1p-Nab3p-Sen1p pathway; m
odulates histone acetylation l
evels in promoter proximal reg
ions to ensure efficient Nrd1p
-dependent termination; requir
ed in transcriptional silencin
g near telomeres and at silent
mating type loci; has a SET d
omain
Stentor CoeruleusSteCoe_262230.000000000000001713908431542013

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:29523178: Saettone A, Garg J, Lambert JP, Nabeel-Shah S, Ponce M, Burtch A, Thuppu Mudalige C, Gingras AC, Pearlman RE, Fillingham J (2018) The bromodomain-containing protein Ibd1 links multiple chromatin-related protein complexes to highly expressed genes in Tetrahymena thermophila. Epigenetics & chromatin 11(1):10

Sequences

>TTHERM_01309130(coding)
ATGGATTAAAGAGATTAAATTCAGATTTCATTAAAGGACTACGCAGAGCTTATAGAAAAT
CGTAAAAGAGTACTAAGAAGTAATACTAACACTGGTAGCAGCAATCAGCAATAACCAGCT
TAAAATAATACTTCGTCTTAAGCAACAACTTCAATCAATGATAGGAAGAATGATAAAAGC
TCTAAAATTAAAAAGGGAAGCGTATAAGATGAAGAACCAGATATTTAAAAGAAAATAAAA
ATAAGCGATTAAGACAACTTAGATAAGTCTAATCAAAGCAGCACTAATAGTGAAAATTAA
AAGAGTAGTTTGAACTCTGCTGCAAATTAGAATATTTAATCTATTTAGAATGATGAAGTG
TTTGAAGAGATATTTAAAAAGTTTGTAGATTTAGAGCGCGATGCTTTTTTGGACATCCCA
GAGTTAAATAGCACTTTACATGGATAGTTTTATTTAAAAGATATGAATAAAATAGACGCT
CCTTATTTATAAGATTCTTTTGTTAAAGTTTATTCTGAATCATAAAATTTGATTACTATT
TCAAATGGATATGTCTAGCAAGGAGCTAATAAAAAGAAAAAGAGGTTTATGACAATTTAG
TCACAAAAAGAATCTAAAACTTTTACATAAGTATGTGACTGCTCTAAACAAGATATATTA
ATACTTTAAAATATAGCATGTCTATCTATGGATCATTAATCATTTTTAAAGCACATAAGA
CCTAATGAAAAATCAGTATATTAATTTAGCGATTTTGCAGATCCAAACATTAATTAAGTG
TTATGGCCTGTTGTTTTACTATCTTGTTATGGACCCCTTAAGGATAACATTAGGGATTTA
TTTACAAATGATTCTTATACTATTAATGATACTTGGGATATCTTTAAATTTGGTAATTAT
CGAAAGGATTCTGCTTTAGATGAGTAAAATGATGAAAATAAATTAAAAGGCTAAAAGGAA
AAGGATAAAAATTTTGAAAGCCAAATGAATATAGAGTCACTCTCTTAAATAAATTTCCCT
TCATAATAGCAAATCCCTCTTTAAAGAAGTTTATCTGTTTAATATTAATAAAACGATGTT
CTTATATGGTTTATTGGCACTAATAGATATTCTATAGTAAATATGTCTCAGCTTATGAAA
GTGGAAGATATGAATAAAGAATTTGTGAAGGAAATTTTTAAAAAGACCAAATTAAGGGAT
ATTACAAAAACTCTTGTTGATTTAATTAAATCTTATAACCAGGTTACAAATAGGAACAAA
GAATTTGTCATCACGGCTGAAAACTGTAAATAAATGATCCATCGTATTGTCAAAATAAGA
AATAATAAGCAATTCAAAAAAAAAGCTCCTCAAGTGACTTCAAATGATGATTTTTATTAT
GCAGTCATTTTAAGATTTTAAGAAAATAGATAAAAATAAACAATGCAGCTTTTAATTAAG
AACTTAGAAACTTCCAAACTTCATTGGATTAATCTAAATTAATCAGAAAGAAATATTATA
ACCTCACTAAATATCCCAGCTCTTGGTCCTCAAGAATTAAAGTTTAACTACTATCTTGAT
ATTTAGTAAAAGGAATCTATTAATCCGAAAGAAATTGCTCTTTCATTCATCAATAGATTT
TTGTTGAGATGGTTTTATGAAAAAAGTGCAATAACACCTTTAAGAGACGCAGAAGTAGAC
AGACTTTTATAATAATCTATTAGGGAAAAAGAATTTTACACTTTCGAAAATATGCCAGAA
AAAAAAAGAAACAAAGAGCGTTGCACTGTTTGTAAATACATTTTGTATAATTTGGAATTT
AAAGGTTGCTTTTATTGTGGAGCATATTATCACACTCAATGCATTCTCTAAGAAGAGGAT
AACCGTAACTAGCATTTTGCATGTGATACTTGTGAGCCATGTAGTATTTGCCACGGGAAA
ATAACTGATGATAATATTACATGCTGTGAGTGTAAAACTCACTTTCACAAAAAGTGTGGT
TTCTCAATAGCTTATGATATGAATACAAGTGATAAATAAATTATGAGGTGGTATTGCGAA
TCTTGTGTTTAATGCTGTATTTGTAATAATAAGCTATCTGATTTTCAAAATGGATATTCT
TTTAAAGATGATTAAATTTACTGCAATGATTGTAATGAGCAGCTTTAAAAGAAAGAGTAT
TGCCCTATTTGTAAAAAATTTTGGTCTTAAGAAACTAACAAAGATATGGTTCAGTGTACT
TGTGCTATGTGGATTCATAGAGCATGTGATCCGATTTTAAAAGATGATAAACTTTATGAT
GAATATAAAAACAATTTAAGGCAATAATATCGTTGCACTAATTGTAGAAAAAGAGTTAGA
AGAGTTTTAATGTGTCAATTTATAAAAGTTCTTTCACATTTAGATTTTTAGAAATTTTTT
ACCAAGAATGAGTTTGAAAAAATACCTAACTACCTCAAGCTTATAAAGAAGCCCATAGAT
TTATATATGATGCAGAGAAAAGCAATCTCTGGCGATTATGATAATGAACCATATGAGCAA
CTTTACAAGGACTTCTTGCTTCTCATATAAAATGCACTGAATTTTAATGCTCATCATCCA
GAAGCTTATAGAGAGGCCACAAAATTAAATTTACTAGGGAGAACTGCATTTTAATATTTT
TAAAATCTTTTAAAAATTGATGAAAAAGAGCTGATAACAATGACTGAAAAAACATCTATT
TAAGGAAAACAAGTCGAATTCATTAAATATGTTGAATAAAACTTCTTAAATATTGTATTT
AGCGCCTCTGCTTAAGCAAATAAATCGCTAACCACTATTGAAATCTATAACAAATAAAGT
GAGAGACAACAATCTAATTAGAGTTAAATAATTGAAGAACCAATTCAAAATAAAAGAGAA
CAAGAAAATTCTGCTTAATATTAAGAATATTTGAGAGATGTTTAAAAAATGGAAGAAAAT
AATATTAAATAATTTAAATACACTGAAGTTAGTAATTTAGTTGAGTAAGGAGATGCCATA
TATAACTATCTATCTTTCCTTTAACAATTGATGAACGAATCCAACTAAATTATTGTAAAA
TTTGAAGATATTTGTAAGATATTTGAGCATATTGCTTCGAAAGGTAAAAACGAAATAAAA
TACATCTAATCAGTTTTAAAAAATGAAACTTTAAACAAAATTGTTAAATACAACCAATAT
TTAAATGATCTCATGAACAACAATACTCTTGATGAATCGAATGAATAAAATTAATTGGAT
AATGCACAGTCAGATAATTCTTCCTAAGAAGGAGGGGTTTCAAGTTAATTTATTTCATTC
CATCATGCTTTGAAATTAGAAATTGAAAACTTCATATAAAAAGGTAAACCATTTAGCTTT
TATGAATGCGTGCCTGTAAAATTTACAAATCAAAATATCAATTTGCTACGATAAAGTTGT
TGCTTTATGTGTGGGGCATTCGATGGTTATAAATCATTACTTTTTTGCACAAGCTGCTTC
GAATCTTATCATCCCTATTGCCTTATGATTCCAGGAAGATAAGAATATTTCAAAGAAAAA
ATGGAAAGAGCCATGAACAATAGGGAATGGAACTGTCCTAAATGCTAGGTCTGCAAAGTT
TGTAGTAAGGGTCCTAACATTACAAAGAATCTTTTTTGCAGAAAATGTGATGCTATGGTT
CATTTTGAATGTGAATTTAAAGACGTTCAAGTATGGAATGAATCTAAAAATGAACTTTAC
TGGTAGTGCTCAGATTGCTTTAATTGTGCCAAATGTTCGTCAAAATCTTTAATTGATGAA
TCAGATAAACAACTCATGATCAATTTAGATTTTACTGATAACTTTTCATTATGCTACAAA
TGTGGTTTTTTGGACGCTTATTACAGATTCTGTAAATTTTGCAACAAATATTGTAAAAAA
ATACCAACTTTACCTAAGCCCGCTAATTAGCAACCTCTTGATGACCTATTTTAAGAGAAA
AGCGTAAGGCTAAAATATTTAGATTAATATCTTGAAGAAGTTCTGTATCAGTGCAAACTG
TGCTAATAAGTTTACCACAAAAAATGCTTTGAAAAAGCTTATCCAGAATATATTTAGTAG
TTCTTTTGCTATACATGCAAAGACTCAAATCAAAGTTACATGTAAAAGATTTATGAAAAT
AGCTTAATTAGCACTAAGTGTAGGATTATCCATATCCGTAAAGTGTAAGAGTTTCTTCCT
ATAGTTGAGCTAATAATAGAAAAGTAGGCTTAAACTTACAAACTAAACAGGAAAGACATA
GGTGATTTCATAGCAGAATATTTACATTATTTCGAAAGCGATTAATTTGGTATTTATAAA
TAAAATACTATGGCTTATGACAAACTTTGTTAACAACTAAGAGATGAAGGAATTCTGATA
ACACCTTATAACATTAAATAAATGGCTATATATGATGAAAAGGTTATTTCACAAACAATA
GAGCAACTAAAAAATAAAAAATCATTTTGGAGAGACACATATATCTAATCCAATTAATTT
TATTATAAATCAGAATAAATTTATTCAATAGCTTACTTAGATTTGTATAAAAGAGGAATA
ACAGCTCCAGAAACAGCAGAAATTGCATATAAATTTTCATTCGAATCTAATGAAGGCGTA
TTTAGACAACTTCAGTATAGCATTTTCAAATTTGAGTTAAAAGAATCAATCAGATATGAT
TACAGATATGATGAAAATGGATAATTAGAAGTTATTTTTATTGAAAATGATAGAAGACAT
CCTCTTCATTTCATAAAAGAGGATTAATTTTAAGTATTTTAACAGAAAGTACAACAAGTT
ATTAGAGAAAGGGGACTATCAAATCAAAGCTCATCTTAAGCTATATAATTCCCTTCAAGA
GATGGATCTAATTAACCTATGGAAATAGAAGATAGTAACCAACCTAGTGAATAATTAATA
CCAATTGCACCTGTTAAATTATCTTAAAATAGATTTTAGCTTTCTCTCGTTTACTCTTCA
TACTTTAATCAAACAATACTTGACTTATAAATGAAAATTTAATAAGAAAATAGCCAATAT
TAAAAATGTTTTAAAACATATATTAACATTCCTATATTAGAAGAAAAGAGCACTGTTTAA
TTATCGACTGTTACTGGAATAAATAAAAGAAGGGATATTGCTTAGTGTATAATCTTATTG
CAAGCTTAAGAAGAATAACTTGTTGCTTCTGTTAGACAAATGCTTGATGAGTTTATGGAA
AAGAAAAAAGATAAAACTAAGATATCTCTTACTCAATAAGTTTTAAATTCATATCAAAAT
TTTTCTAAGAGTATACTTGGATCTGTTTATTAAACACCTATGTCATATTAAGAAATCATC
AATTAATTCAGAGAAGCTTAGAAAAAATTAATTCTTGTTGATAATAATATAATCGATGAT
CCTATGAGAGAAATACCTTGCTAGTTATGCTCTCTAAAAGGTACAAGAAAAATGTGTGGA
AGGCTTCTCAATTTCGATGTTGATAAATGGGTTCATGCTAATTGTGCTCTTTGGAGTACA
GAAGTTAAAGAAAATATAGATGGTGCTCTAAAAAATTTCATACCAGCTTACAAAAAGTCT
CTATAAGTGTAATGTAAACATTGTAATAAATTTGGAGCCACTATCTCTTGTATGATAGCT
AGTTGCAAAGATAAGTACCATTTCCCTTGTTTATTGAAATCAAATGGTTTTATGACAGAT
CAAAAAACCGTTCTTTGCAAGAGCTGTTGGGATATAATCCTTAAAAACGATGACACTGAA
ATTATTTTAAAAATGCAATATTTAAAATTGGTCAACAATTTTAACACAGATAGAAGAATT
TTTATATCACTTACAAAATAAGAAGGAGGAAACATCGATTTTAGTGGAGAGTGCTATAAT
AGATTTGGTTCTTTTATACTTGTCAATCTTGACACACAAGAAACAAATGATGATGAATTT
TTCTCATCTTATTTCTTTATGAGATACATTAGACCTTTTGTTTCACAAAAATATCAGTCT
TATGTTACTGCATTTTGGTTGAAAAAAAAGAAAGATGAATATATTTTAAAATCTTGTTTG
CTTGCAGAAACTAACAAAATATTTTCATAGACAAAAAATATTGATGAAAACAAAAATGAA
TTTTCAATAGAAAAAGATAGACCATTCACTAATGAATTAAGTGCCAACATAAAAAATTTA
GCAGGATATAAAGAAATAAGCGAATCAAACAATAATATACCTAGATTTACTAACAATGTA
TTGAAAGATAAAGATATATTTAATCATGACCAACTTGATTGCTTCACTTCATTAAAAGGT
ATACAATAGCTCCTCTAAGAAAAGATAAATTAAATATACTAAAGATACAAGGGTGATTAA
CCTAATAAAAGTACTGATGTTAACAAATTTGTTATGGAATACATTGGTTTTGGTATTCCT
CAAATAGTCAAAGCTTGCTAATAGTCTTCAAAATAAAATAAAAATAACAATATATTCTAG
AACATTTAAAATATCAAAGTAAACTCGTTTTAAGAGCTCTTTTACAAAGAGTAAGTAGAA
AATTTTAACCCATTTGAAAAGTAGAAACTATTAGAAAAAATGCATCCCACAATCATGTAA
AATTAAAAATAGTAACAATAATTACAAAACTTAGGATAGTAATAAATGAATTCAAAAGAA
AATTAGTAGTCTTCACATTTAAATATTCCAATTTTACAGCATTTAAGTAATAAAAAATAA
GGTTTTGTCCACTTCCAAAAGCAGAGCTAGAAACCTATTATGGGAAATAATTATTTCATC
AGACCCGATGATATTATGCTAGAAGCTAATCCCGATTACATGAAATAAGATACTCGTTAA
ACGATAAGAGAAAAAGAAATAGAAAAAAAGATTAAAGCAGAATATCCGAATTACATAAAT
AGCAAAAAGAGACATCTAAATATTTATGCTGGTCCTTCTAAAATTCACAAATATGGGTTA
TTTGCAAAAACTTACTTTAAATAAGACGATATTGTTGTTGAATATCTTGGTGAAACAATT
AGATAAGTTCTTGCAGACTATAGAGAGAAGATATACAAATAAAGAGGTTTTGGAGATTGC
TATATGTTCAAAGCATGCCCTGATAAAATTATTGATGCCACTTTTAAAGGGAATGAAGCC
AGATACTTAAATCACTCTTGCAATCCAAATTGCTCCAGTTTAGTTATTGAATACGAAAAA
GATTCAAAAATCATAATTTATGCAAAGAGAGATATAAAACCTGGAGAGGAGCTTACATAT
GATTACTGCTTTGATATAGAAGAAGAGAAGATTAACTGTAACTGCAATGATCCTAATTGC
ACAAGAATAATGAATTGA


>TTHERM_01309130(protein)
MDQRDQIQISLKDYAELIENRKRVLRSNTNTGSSNQQQPAQNNTSSQATTSINDRKNDKS
SKIKKGSVQDEEPDIQKKIKISDQDNLDKSNQSSTNSENQKSSLNSAANQNIQSIQNDEV
FEEIFKKFVDLERDAFLDIPELNSTLHGQFYLKDMNKIDAPYLQDSFVKVYSESQNLITI
SNGYVQQGANKKKKRFMTIQSQKESKTFTQVCDCSKQDILILQNIACLSMDHQSFLKHIR
PNEKSVYQFSDFADPNINQVLWPVVLLSCYGPLKDNIRDLFTNDSYTINDTWDIFKFGNY
RKDSALDEQNDENKLKGQKEKDKNFESQMNIESLSQINFPSQQQIPLQRSLSVQYQQNDV
LIWFIGTNRYSIVNMSQLMKVEDMNKEFVKEIFKKTKLRDITKTLVDLIKSYNQVTNRNK
EFVITAENCKQMIHRIVKIRNNKQFKKKAPQVTSNDDFYYAVILRFQENRQKQTMQLLIK
NLETSKLHWINLNQSERNIITSLNIPALGPQELKFNYYLDIQQKESINPKEIALSFINRF
LLRWFYEKSAITPLRDAEVDRLLQQSIREKEFYTFENMPEKKRNKERCTVCKYILYNLEF
KGCFYCGAYYHTQCILQEEDNRNQHFACDTCEPCSICHGKITDDNITCCECKTHFHKKCG
FSIAYDMNTSDKQIMRWYCESCVQCCICNNKLSDFQNGYSFKDDQIYCNDCNEQLQKKEY
CPICKKFWSQETNKDMVQCTCAMWIHRACDPILKDDKLYDEYKNNLRQQYRCTNCRKRVR
RVLMCQFIKVLSHLDFQKFFTKNEFEKIPNYLKLIKKPIDLYMMQRKAISGDYDNEPYEQ
LYKDFLLLIQNALNFNAHHPEAYREATKLNLLGRTAFQYFQNLLKIDEKELITMTEKTSI
QGKQVEFIKYVEQNFLNIVFSASAQANKSLTTIEIYNKQSERQQSNQSQIIEEPIQNKRE
QENSAQYQEYLRDVQKMEENNIKQFKYTEVSNLVEQGDAIYNYLSFLQQLMNESNQIIVK
FEDICKIFEHIASKGKNEIKYIQSVLKNETLNKIVKYNQYLNDLMNNNTLDESNEQNQLD
NAQSDNSSQEGGVSSQFISFHHALKLEIENFIQKGKPFSFYECVPVKFTNQNINLLRQSC
CFMCGAFDGYKSLLFCTSCFESYHPYCLMIPGRQEYFKEKMERAMNNREWNCPKCQVCKV
CSKGPNITKNLFCRKCDAMVHFECEFKDVQVWNESKNELYWQCSDCFNCAKCSSKSLIDE
SDKQLMINLDFTDNFSLCYKCGFLDAYYRFCKFCNKYCKKIPTLPKPANQQPLDDLFQEK
SVRLKYLDQYLEEVLYQCKLCQQVYHKKCFEKAYPEYIQQFFCYTCKDSNQSYMQKIYEN
SLISTKCRIIHIRKVQEFLPIVELIIEKQAQTYKLNRKDIGDFIAEYLHYFESDQFGIYK
QNTMAYDKLCQQLRDEGILITPYNIKQMAIYDEKVISQTIEQLKNKKSFWRDTYIQSNQF
YYKSEQIYSIAYLDLYKRGITAPETAEIAYKFSFESNEGVFRQLQYSIFKFELKESIRYD
YRYDENGQLEVIFIENDRRHPLHFIKEDQFQVFQQKVQQVIRERGLSNQSSSQAIQFPSR
DGSNQPMEIEDSNQPSEQLIPIAPVKLSQNRFQLSLVYSSYFNQTILDLQMKIQQENSQY
QKCFKTYINIPILEEKSTVQLSTVTGINKRRDIAQCIILLQAQEEQLVASVRQMLDEFME
KKKDKTKISLTQQVLNSYQNFSKSILGSVYQTPMSYQEIINQFREAQKKLILVDNNIIDD
PMREIPCQLCSLKGTRKMCGRLLNFDVDKWVHANCALWSTEVKENIDGALKNFIPAYKKS
LQVQCKHCNKFGATISCMIASCKDKYHFPCLLKSNGFMTDQKTVLCKSCWDIILKNDDTE
IILKMQYLKLVNNFNTDRRIFISLTKQEGGNIDFSGECYNRFGSFILVNLDTQETNDDEF
FSSYFFMRYIRPFVSQKYQSYVTAFWLKKKKDEYILKSCLLAETNKIFSQTKNIDENKNE
FSIEKDRPFTNELSANIKNLAGYKEISESNNNIPRFTNNVLKDKDIFNHDQLDCFTSLKG
IQQLLQEKINQIYQRYKGDQPNKSTDVNKFVMEYIGFGIPQIVKACQQSSKQNKNNNIFQ
NIQNIKVNSFQELFYKEQVENFNPFEKQKLLEKMHPTIMQNQKQQQQLQNLGQQQMNSKE
NQQSSHLNIPILQHLSNKKQGFVHFQKQSQKPIMGNNYFIRPDDIMLEANPDYMKQDTRQ
TIREKEIEKKIKAEYPNYINSKKRHLNIYAGPSKIHKYGLFAKTYFKQDDIVVEYLGETI
RQVLADYREKIYKQRGFGDCYMFKACPDKIIDATFKGNEARYLNHSCNPNCSSLVIEYEK
DSKIIIYAKRDIKPGEELTYDYCFDIEEEKINCNCNDPNCTRIMN


>TTHERM_01309130(gene)
ATGGATTAAAGAGATTAAATTCAGATTTCATTAAAGGACTACGCAGAGCTTATAGAAAAT
CGTAAAAGAGTACTAAGAAGTAATACTAACACTGGTAGCAGCAATCAGCAATAACCAGCT
TAAAATAATACTTCGTCTTAAGCAACAACTTCAATCAATGATGTAAAAAATTTATATTAA
AAATTTCAATTGTCTATAAGCATTTGTGCACCTTTAAAAAATAGAGGAAGAATGATAAAA
GCTCTAAAATTAAAAAGGGAAGCGTATAAGATGAAGGTAATTTAGCTAAAATAACCTATT
TCTTGATTTTATTGTGAAAATATTTTTATAAACGGATATAATATTTTATTTTTATGCTTT
TAATTGTCCAATAATTTAAAGCAAGCAGTAGGATTGATCTGTTTTTTTTAAAAAATATAG
AACCAGATATTTAAAAGAAAATAAAAATAAGCGATTAAGACAACTTAGATAAGTCTAATC
AAAGCAGCACTAATAGTGAAAATTAAAAGAGTAGTTTGAACTCTGCTGCAAATTAGAATA
TTTAATCTATTTAGAATGATGAAGTGTTTGAAGAGATATTTAAAAAGTTTGTAGATTTAG
AGCGCGATGCTTTTTTGGACATCCCAGAGTTAAATAGCACTTTACATGGATAGTTTTATT
TAAAAGATATGAATAAAATAGACGCTCCTTATTTATAAGATTCTTTTGTTAAAGTTTATT
CTGAATCATAAAATTTGATTACTATTTCAAATGGATATGTCTAGCAAGGAGCTAATAAAA
AGAAAAAGAGGTTTATGACAATTTAGTCACAAAAAGAATCTAAAACTTTTACATAAGTAT
GTGACTGCTCTAAACAAGATATATTAATACTTTAAAATATAGCATGTCTATCTATGGATC
ATTAATCATTTTTAAAGCACATAAGACCTAATGAAAAATCAGTATATTAATTTAGCGATT
TTGCAGATCCAAACATTAATTAAGTGTTATGGCCTGTTGTTTTACTATCTTGTTATGGAC
CCCTTAAGGATAACATTAGGGATTTATTTACAAATGATTCTTATACTATTAATGATACTT
GGGATATCTTTAAATTTGGTAATTATCGAAAGGATTCTGCTTTAGATGAGTAAAATGATG
AAAGTAAATTAAAATTTAGCTAAATTGATATTTTTCCTATTTTATCATTTGAGTTTATTA
TTTCTTTCGTTAATTGTGTTAAAATATTTTATTGAATAATTTTTTATATTCGTATTTATA
GATAAATTAAAAGGCTAAAAGGAAAAGGATAAAAATTTTGAAAGCCAAATGAATATAGAG
TCACTCTCTTAAATAAATTTCCCTTCATAATAGCAAATCCCTCTTTAAAGAAGTTTATCT
GTTTAATATTAATAAAACGATGTTCTTATATGGTTTATTGGCACTAATAGATATTCTATG
TAATCTTCTTATAATGATTTATTTTTTTTATCAAAACTAACTATTGTAATTACTTTAAAT
TTTTTTTTTTTTCCCTTTATATTATAGAGTAAATATGTCTCAGCTTATGAAAGTGGAAGA
TATGAATAAAGAATTTGTGAAGGAAATTTTTAAAAAGACCAAATTAAGGGATATTACAAA
AACTCTTGTTGATTTAATTAAATCTTATAACCAGGTTACAAATAGGAACAAAGAATTTGT
CATCACGGCTGAAAACTGTAAATAAATGATCCATCGTATTGTCAAAATAAGAAATAATAA
GCAATTCAAAAAAAAAGCTCCTCAAGTGACTTCAAATGATGATTTTTATTATGCAGTCAT
TTTAAGATTTTAAGAAAATAGATAAAAATAAACAATGCAGCTTTTAATTAAGAACTTAGA
AACTTCCAAACTTCATTGGATTAATCTAAATTAATCAGAAAGAAATATTATAACCTCACT
AAATATCCCAGCTCTTGGTCCTCAAGAATTAAAGTTTAACTACTATCTTGATATTTAGTA
AAAGGAATCTATTAATCCGAAAGAAATTGTAATTTAAAGTTTAATCTTATTTAATCATGC
TTATTATTCTTATTGAAAAAGGCTCTTTCATTCATCAATAGATTTTTGTTGAGATGGTTT
TATGAAAAAAGTGCAATAACACCTTTAAGAGACGCAGAAGTAGACAGACTTTTATAATAA
TCTATTAGGGAAAAAGAATTTTACACTTTCGAAAATATGCCAGAAAAAAAAAGAAACAAA
GAGCGTTGCACTGTTTGTAAATACATTTTGTATAATTTGGAATTTAAAGGTTGCTTTTAT
TGTGGAGCATATTATCACACTCAATGCATTCTCTAAGAAGAGGATAACCGTAACTAGCAT
GTAACTTTTTTAATATTTAAGTTGTATTTGTAAATATTTTTTAAATTAGTTTGCATGTGA
TACTTGTGAGCCATGTAGTATTTGCCACGGGAAAATAACTGATGATAATATTACATGCTG
TGAGTGTAAAACTCACTTTCACAAAAAGTGTGGTTTCTCAATAGCTTATGATATGAATAC
AAGTGATAAATAAATTATGAGGTGGTATTGCGAATCTTGTGTTTAATGCTGTATTTGTAA
TAATAAGCTATCTGATTTTCAAAATGGATATTCGTAATTTACTAAATAATATTTAAAGTT
TATTTAAATAAATTATTTATTTTAATTTATAGTTTTAAAGATGATTAAATTTACTGCAAT
GATTGTAATGAGCAGCTTTAAAAGAAAGAGTATTGCCCTATTTGTAAAAAATTTTGGTCT
TAAGAAACTAACAAAGATATGGTTCAGTGTACTTGTGCTATGTGGATTCATAGAGCATGT
GATCCGATTTTAAAAGATGATAAACTTTATGATGAATATAAAAACAATTTAAGGCAATAA
TATCGTTGCACTAATTGTAGAAAAAGAGTTAGAAGAGTTTTAATGTGTCAATTTATAAAA
GTTCTTTCACAGTAAATTTTACAATATTTTTATATGTAATAAATATGTTTATAAAAATTA
ATATTATTAGTTTAGATTTTTAGAAATTTTTTACCAAGAATGAGTTTGAAAAAATACCTA
ACTACCTCAAGCTTATAAAGAAGCCCATAGATTTATATATGATGCAGAGAAAAGCAATCT
CTGGCGATTATGATAATGAACCATATGAGCAACTTTACAAGGACTTCTTGCTTCTCATAT
AAAATGCACTGAATTTTAATGCTCATCATCCAGAAGCTTATAGAGAGGCCACAAAATTAA
ATTTACTAGGGAGAACTGCATTTTAATATTTTTAAAATCTTTTAAAAATTGATGAAAAAG
AGCTGATAACAATGACTGAAAAAACATCTATTTAAGGAAAACAAGTCGAATTCATTAAAT
ATGTTGAATAAAACTTCTTAAATATTGTATTTAGCGCCTCTGCTTAAGCAAATAAATCGC
TAACCACTATTGAAATCTATAACAAATAAAGTGAGAGTAAGATATATTTAAATTTTTTTT
TGATGTTTATCTGCTTTATAAAAAGGACAACAATCTAATTAGAGTTAAATAATTGAAGAA
CCAATTCAAAATAAAAGAGAACAAGAAAATTCTGCTTAATATTAAGAATATTTGAGAGAT
GTTTAAAAAATGGAAGAAAATAATATTAAATAATTTAAATACACTGAAGTTAGTAATTTA
GTTGAGTAAGGAGATGCCATATATAACTATCTATCTTTCCTTTAACAATTGATGAACGAA
TCCAACTAAATTATTGTAAAATTTGAAGATATTTGTAAGATATTTGAGCATATTGCTTCG
AAAGGTAAAAACGAAATAAAATACATCTAATCAGTTTTAAAAAATGAAACTTTAAACAAA
ATTGTTAAATACAACCAATATTTAAATGATCTCATGAACAACAATACTCTTGATGAATCG
AATGAATAAAATTAATTGGATAATGCACAGTCAGATAATTCTTCCTAAGAAGGAGGGGTT
TCAAGTTAATTTATTTCATTCCATCATGCTTTGAAATTAGAAATTGAAAACTTCATATAA
AAAGGTTTGAATTTTTTTATTCATTTAAAATTTTTTTATTTAGATATTTATAAATATAAA
GGTAAACCATTTAGCTTTTATGAATGCGTGCCTGTAAAATTTACAAATCAAAATATCAAT
TTGCTACGATAAAGTTGTTGCTTTATGTGTGGGGCATTCGATGGTTATAAATCATTACTT
TTTTGCACAAGCTGCTTCGAATCTTATCATCCCTATTGCCTTATGATTCCAGGAAGATAA
GAATATTTCAAAGAAAAAATGGAAAGAGCCATGAACGTAATAATTTTATTATTTACATTT
TTTTATAAAATTTATCTCCAGAATAGGGAATGGAACTGTCCTAAATGCTAGGTCTGCAAA
GTTTGTAGTAAGGGTCCTAACATTACAAAGAATCTTTTTTGCAGAAAATGTGATGCTATG
GTTCATTTTGAATGTGAATTTAAAGACGTTCAAGTATGGAATGAATCTAAAAATGAACTT
TACTGGTAGTGCTCAGATTGCTTTAATTGTGCCAAATGTTCGTCAAAATCTTTAATTGAT
GAATCAGATAAACAACTCATGATCAATTTAGATTTTACTGATAACTTTTCATTATGCTAC
AAATGTGGTTTTTTGGACGCTTATTACAGATTCTGTAAATTTTGCAACAAATATTGTAAA
AAAATACCAACTTTACCTAAGCCCGCTAATTAGCAACCTCTTGATGACCTATTTTAAGAG
AAAAGCGTAAATTAAAATAAACACATTTAATAAATTAAATTTGATTAACTTAAAAGGTAA
GGCTAAAATATTTAGATTAATATCTTGAAGAAGTTCTGTATCAGTGCAAACTGTGCTAAT
AAGTTTACCACAAAAAATGCTTTGAAAAAGCTTATCCAGAATATATTTAGTAGTTCTTTT
GCTATACATGCAAAGACTCAAATCAAAGTTACATGTAAAAGATTTATGAAAATAGCTTAA
TTAGCACTAAGTGTAGGATTATCCATATCCGTAAAGTGTAAGAGTTTCTTCCTATAGTTG
AGCTAATAATAGAAAAGTAGGCTTAAACTTACAAACTAAACAGGAAAGACATAGGTGATT
TCATAGCAGAATATTTACATTATTTCGAAAGCGATTAAGTAAGCTCATTTTTGGAAAATT
ATGCAAATAATTAATTTTTTTAAAACTAGTTTGGTATTTATAAATAAAATACTATGGCTT
ATGACAAACTTTGTTAACAACTAAGAGATGAAGGAATTCTGATAACACCTTATAACATTA
AATAAATGGCTATATATGATGAAAAGGTTATTTCACAAACAATAGAGCAACTAAAAAATA
AAAAATCATTTTGGAGAGACACATATATCTAATCCAATTAATTTTATTATAAATCAGAAT
AAATTTATTCAATAGCTTACTTAGATTTGTATAAAAGAGGAATAACAGCTCCAGAAACAG
CAGAAATTGCATATGTAATGATATAAAAATTATTTACTTAATTAAAGTTTTTTTAAAATA
TAAACATTTAAGGCATCTTATTTTAATTAATTATTAATTTGTTTATATCTTTAAAATAAA
TAATTACTTTTTTAATTAAATTTTAGAAATTTTCATTCGAATCTAATGAAGGCGTATTTA
GACAACTTCAGTATAGCATTTTCAAATTTGAGTTAAAAGAATCAATCAGATATGATTACA
GATATGATGAAAATGGATAATTAGAAGTTATTTTTATTGAAAATGATAGAAGACATCCTC
TTCATTTCATAAAAGAGGATTAATTTTAAGTATTTTAACAGAAAGTACAACAAGTTATTA
GAGAAAGGGGACTATCAAATCAAAGCTCATCTTAAGCTATATAATTCCCTTCAAGAGATG
GATCTAATTAACCTATGGAAATAGAAGATAGTAACCAACCTAGTGAATAATTAATACCAA
TTGCACCTGTTAAATTATCTTAAAATAGATTTTAGCTTTCTCTCGTTTACTCTTCATACT
TTAATCAAACAATACTTGACTTATAAATGAAAATTTAATAAGAAAATAGCCAATATTAAA
AATGTTTTAAAACATATATTAACATTCCTATATTAGAAGAAAAGAGCACTGTTTAATTAT
CGACTGTTACTGGAATAAATAAAAGAAGGGATATTGCTTAGTGTATAATCTTATTGCAAG
CTTAAGAAGAATAACGTAAATTTAAAAACTATTAGATTTCAGAAATTTTATTTTATTAAA
ATTTAAGTTGTTGCTTCTGTTAGACAAATGCTTGATGAGTTTATGGAAAAGAAAAAAGAT
AAAACTAAGATATCTCTTACTCAATAAGTTTTAAATTCATGTAAATTAATAGTTAATTAT
AATAAATATTCATTAAATTAAAAAAATTAGATCAAAATTTTTCTAAGAGTATACTTGGAT
CTGTTTATTAAACACCTATGTCATATTAAGAAATCATCAATTAATTCAGAGAAGCTTAGA
AAAGTAAATTTTATATAAAATAATCAATTAATAAAACACCATAAATTTATAGAATTAATT
CTTGTTGATAATAATATAATCGATGATCCTATGAGAGAAATACCTTGCTAGTTATGCTCT
CTAAAAGGTACAAGAAAAGTAAGATATTTATTTATTTAATTATTATCTACCGTGGGTACG
CATGAATAAGGATTATCAAAAAAAAAATCTTTTTTAAAATTTCTTATCCTTTTTAATCCT
TATTTTAAATTCATCCTTATTCAAAAATTATCCTTATTCATGCGTACCCACGGTATTTCA
AATTTTAATGTTTTATGAAAAATTATATTAGATGTGTGGAAGGCTTCTCAATTTCGATGT
TGATAAATGGGTTCATGCTAATTGTGCTCTTTGGAGTACAGAAGTTAAAGAAAATATAGA
TGGTGCTCTAAAAAATTTCATACCAGCTTACAAAAAGTCTCTATAAGTGGTATCATTAAT
TGATTGTTAACTCTTTTTTAATTAGATACTAATTTTATTTAACTTAAAGTAATGTAAACA
TTGTAATAAATTTGGAGCCACTATCTCTTGTATGATAGCTAGTTGCAAAGATAAGTACCA
TTTCCCTTGTTTATTGAAATCAAATGGTTTTATGACAGATCAAAAAACCGTTCTTTGCAA
GAGCTGTTGGGATATAATCCTTAAAAACGATGACACTGAAATTATTTTAAAAGTAAAAAT
AATTAATTAATTTTACTTTTACTATTTTAAGCGATTCATAAAAATAAAATAATATTTTTA
AATAGATGCAATATTTAAAATTGGTCAACAATTTTAACACAGATAGAAGAATTTTTATAT
CACTTACAAAATAAGAAGGAGGAAACATCGATTTTAGTGGAGAGTGCTATAATAGATTTG
GTTCTTTTATACTTGTCAATCTTGACACACAAGAAACAAATGATGATGAATTTTTCTCAT
CTTATTTCTTTATGAGATACATTAGACCTTTTGTTTCACAAAAATATCAGTCTTATGTAA
ATTTTTAAAATAAATTTTTTTAAAAACAAGGCTTATATTATTTATTTGAGTGCCTGCTTT
TAATTGATAGTAAATTTTATTATAAAATAAATAAATAAGGTTACTGCATTTTGGTTGAAA
AAAAAGAAAGATGAATATATTTTAAAATCTTGTTTGCTTGCAGAAACTAACAAAATATTT
TCATAGACAAAAAATATTGATGAAAACAAAAATGAATTTTCAATAGAAAAAGATAGACCA
TTCACTAATGAATTAAGTGCCAACATAAAAAATTTAGCAGGATATAAAGAAATAAGCGAA
TCAAACAATAATATACCTAGATTTACTAACAATGTATTGAAAGATAAAGATATATTTAAT
CATGACCAACTTGATTGCTTCACTTCATTAAAAGGTATACAATAGCTCCTCTAAGAAAAG
ATAAATTAAATATACTAAAGATACAAGGGTGATTAACCTAATAAAAGTACTGATGTTAAC
AAATTTGTTATGGAATACATTGGTTTTGGTATTCCTCAAATAGTCAAAGCTTGCTAATAG
TCTTCAAAATAAAATAAAAATAACAATATATTCTAGAACATTTAAAATATCAAAGTAAAC
TCGTTTTAAGAGCTCTTTTACAAAGAGTAAGTAGAAAATTTTAACCCATTTGAAAAGTAG
AAACTATTAGAAAAAATGCATCCCACAATCATGTAAAATTAAAAATAGTAACAATAATTA
CAAAACTTAGGATAGTAATAAATGAATTCAAAAGAAAATTAGTAGTCTTCACATTTAAAT
ATTCCAATTTTACAGCATTTAAGTAATAAAAAATAAGGTAAATTTATTTTAGCTAATTAA
GTTTTTGTTGTTTTAATCTAATAAATTAAATTAGGTTTTGTCCACTTCCAAAAGCAGAGC
TAGAAACCTATTATGGGAAATAATTATTTCATCAGACCCGATGATATTATGCTAGAAGCT
AATCCCGATTACATGAAATAAGATACTCGTTAAACGATAAGAGAAAAAGAAATAGAAAAA
AAGATTAAAGCAGAATATCCGAATTACATAAATAGCAAAAAGAGACATCTAAATATTTAT
GCTGGTCCTTCTAAAATTCACAAATATGGGTTATTTGCAAAAACTTAGTAATTAATATAT
TTTCTTATTTATATGATTTCAATGTTCAAAAATTAATTAATTGTGTTATTTATTTCTATT
AGCTTTAAATAAGACGATATTGTTGTTGAATATCTTGGTGAAACAATTAGATAAGTTCTT
GCAGACTATAGAGAGAAGATATACAAATAAAGAGGTTTTGGAGATTGCTATATGTTCAAA
GCATGCCCTGATAAAATTATTGATGCCACTTTTAAAGGGAATGAAGCCAGATACTTAAAT
CACTCTTGCAATGTAAATATTTCAAAAAATATTTTATTTTTATTAATTTACTTTTAAAAA
GCCAAATTGCTCCAGTTTAGTTATTGAATACGAAAAAGATTCAAAAATCATAATTTATGC
AAAGAGAGATATAAAACCTGGAGAGGAGCTTACATATGATTACTGCTTTGATATAGAAGA
AGAGAAGATTAACTGTAACTGCAATGATCCTAATTGCACAAGAATAATGAATTGA