Identifiers and Description

Gene Model Identifier

TTHERM_01309130

Standard Name

MLL1 (Mixed lineage leukemia 1)

Aliases

PreTt09136 | 319.m00018

Description

SET domain containing protein; homolog to MLL proteins in mammals, Trithorax in Drosophila, and SET1 in yeasts.

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_01309130

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_20980.19.997093137033517e-262SET domain-containing protein
(2325 aa)
OxytrichaContig20462.0.g587.002264059090237e-38PHD-finger
DictyBaseDDB_G02892579.99648502569394e-38set1 on chromosome: 5 position
2551579 to 2556233
WormBaseWBGene000047823.000842737734004e-34locus:set-2 Probable histone
-lysine N-methyltransferase se
t-2 status:Partially_confirm
ed UniProt:Q18221 protein_
id:CCD65735.1
SGDYHR119W1.000137892321693e-31SET1 Histone methyltransferase
, subunit of the COMPASS (Set1
C) complex; COMPASS methylates
histone H3K4; Set1p-dependent
H3K4 trimethylation recruits
Nrd1p, allowing efficient term
ination of snoRNAs and cryptic
unstable transcripts (CUTs) b
y Nrd1p-Nab3p-Sen1p pathway; m
odulates histone acetylation l
evels in promoter proximal reg
ions to ensure efficient Nrd1p
-dependent termination; requir
ed in transcriptional silencin
g near telomeres and at silent
mating type loci; has a SET d
omain
Stentor CoeruleusSteCoe_262230.000000000000001713908431542013

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_01309130(coding)
ATGGATTAAAGAGATTAAATTCAGATTTCATTAAAGGACTACGCAGAGCTTATAGAAAAT
CGTAAAAGAGTACTAAGAAGTAATACTAACACTGGTAGCAGCAATCAGCAATAACCAGCT
TAAAATAATACTTCGTCTTAAGCAACAACTTCAATCAATGATAGGAAGAATGATAAAAGC
TCTAAAATTAAAAAGGGAAGCGTATAAGATGAAGAACCAGATATTTAAAAGAAAATAAAA
ATAAGCGATTAAGACAACTTAGATAAGTCTAATCAAAGCAGCACTAATAGTGAAAATTAA
AAGAGTAGTTTGAACTCTGCTGCAAATTAGAATATTTAATCTATTTAGAATGATGAAGTG
TTTGAAGAGATATTTAAAAAGTTTGTAGATTTAGAGCGCGATGCTTTTTTGGACATCCCA
GAGTTAAATAGCACTTTACATGGATAGTTTTATTTAAAAGATATGAATAAAATAGACGCT
CCTTATTTATAAGATTCTTTTGTTAAAGTTTATTCTGAATCATAAAATTTGATTACTATT
TCAAATGGATATGTCTAGCAAGGAGCTAATAAAAAGAAAAAGAGGTTTATGACAATTTAG
TCACAAAAAGAATCTAAAACTTTTACATAAGTATGTGACTGCTCTAAACAAGATATATTA
ATACTTTAAAATATAGCATGTCTATCTATGGATCATTAATCATTTTTAAAGCACATAAGA
CCTAATGAAAAATCAGTATATTAATTTAGCGATTTTGCAGATCCAAACATTAATTAAGTG
TTATGGCCTGTTGTTTTACTATCTTGTTATGGACCCCTTAAGGATAACATTAGGGATTTA
TTTACAAATGATTCTTATACTATTAATGATACTTGGGATATCTTTAAATTTGGTAATTAT
CGAAAGGATTCTGCTTTAGATGAGTAAAATGATGAAAATAAATTAAAAGGCTAAAAGGAA
AAGGATAAAAATTTTGAAAGCCAAATGAATATAGAGTCACTCTCTTAAATAAATTTCCCT
TCATAATAGCAAATCCCTCTTTAAAGAAGTTTATCTGTTTAATATTAATAAAACGATGTT
CTTATATGGTTTATTGGCACTAATAGATATTCTATAGTAAATATGTCTCAGCTTATGAAA
GTGGAAGATATGAATAAAGAATTTGTGAAGGAAATTTTTAAAAAGACCAAATTAAGGGAT
ATTACAAAAACTCTTGTTGATTTAATTAAATCTTATAACCAGGTTACAAATAGGAACAAA
GAATTTGTCATCACGGCTGAAAACTGTAAATAAATGATCCATCGTATTGTCAAAATAAGA
AATAATAAGCAATTCAAAAAAAAAGCTCCTCAAGTGACTTCAAATGATGATTTTTATTAT
GCAGTCATTTTAAGATTTTAAGAAAATAGATAAAAATAAACAATGCAGCTTTTAATTAAG
AACTTAGAAACTTCCAAACTTCATTGGATTAATCTAAATTAATCAGAAAGAAATATTATA
ACCTCACTAAATATCCCAGCTCTTGGTCCTCAAGAATTAAAGTTTAACTACTATCTTGAT
ATTTAGTAAAAGGAATCTATTAATCCGAAAGAAATTGCTCTTTCATTCATCAATAGATTT
TTGTTGAGATGGTTTTATGAAAAAAGTGCAATAACACCTTTAAGAGACGCAGAAGTAGAC
AGACTTTTATAATAATCTATTAGGGAAAAAGAATTTTACACTTTCGAAAATATGCCAGAA
AAAAAAAGAAACAAAGAGCGTTGCACTGTTTGTAAATACATTTTGTATAATTTGGAATTT
AAAGGTTGCTTTTATTGTGGAGCATATTATCACACTCAATGCATTCTCTAAGAAGAGGAT
AACCGTAACTAGCATTTTGCATGTGATACTTGTGAGCCATGTAGTATTTGCCACGGGAAA
ATAACTGATGATAATATTACATGCTGTGAGTGTAAAACTCACTTTCACAAAAAGTGTGGT
TTCTCAATAGCTTATGATATGAATACAAGTGATAAATAAATTATGAGGTGGTATTGCGAA
TCTTGTGTTTAATGCTGTATTTGTAATAATAAGCTATCTGATTTTCAAAATGGATATTCT
TTTAAAGATGATTAAATTTACTGCAATGATTGTAATGAGCAGCTTTAAAAGAAAGAGTAT
TGCCCTATTTGTAAAAAATTTTGGTCTTAAGAAACTAACAAAGATATGGTTCAGTGTACT
TGTGCTATGTGGATTCATAGAGCATGTGATCCGATTTTAAAAGATGATAAACTTTATGAT
GAATATAAAAACAATTTAAGGCAATAATATCGTTGCACTAATTGTAGAAAAAGAGTTAGA
AGAGTTTTAATGTGTCAATTTATAAAAGTTCTTTCACATTTAGATTTTTAGAAATTTTTT
ACCAAGAATGAGTTTGAAAAAATACCTAACTACCTCAAGCTTATAAAGAAGCCCATAGAT
TTATATATGATGCAGAGAAAAGCAATCTCTGGCGATTATGATAATGAACCATATGAGCAA
CTTTACAAGGACTTCTTGCTTCTCATATAAAATGCACTGAATTTTAATGCTCATCATCCA
GAAGCTTATAGAGAGGCCACAAAATTAAATTTACTAGGGAGAACTGCATTTTAATATTTT
TAAAATCTTTTAAAAATTGATGAAAAAGAGCTGATAACAATGACTGAAAAAACATCTATT
TAAGGAAAACAAGTCGAATTCATTAAATATGTTGAATAAAACTTCTTAAATATTGTATTT
AGCGCCTCTGCTTAAGCAAATAAATCGCTAACCACTATTGAAATCTATAACAAATAAAGT
GAGAGACAACAATCTAATTAGAGTTAAATAATTGAAGAACCAATTCAAAATAAAAGAGAA
CAAGAAAATTCTGCTTAATATTAAGAATATTTGAGAGATGTTTAAAAAATGGAAGAAAAT
AATATTAAATAATTTAAATACACTGAAGTTAGTAATTTAGTTGAGTAAGGAGATGCCATA
TATAACTATCTATCTTTCCTTTAACAATTGATGAACGAATCCAACTAAATTATTGTAAAA
TTTGAAGATATTTGTAAGATATTTGAGCATATTGCTTCGAAAGGTAAAAACGAAATAAAA
TACATCTAATCAGTTTTAAAAAATGAAACTTTAAACAAAATTGTTAAATACAACCAATAT
TTAAATGATCTCATGAACAACAATACTCTTGATGAATCGAATGAATAAAATTAATTGGAT
AATGCACAGTCAGATAATTCTTCCTAAGAAGGAGGGGTTTCAAGTTAATTTATTTCATTC
CATCATGCTTTGAAATTAGAAATTGAAAACTTCATATAAAAAGGTAAACCATTTAGCTTT
TATGAATGCGTGCCTGTAAAATTTACAAATCAAAATATCAATTTGCTACGATAAAGTTGT
TGCTTTATGTGTGGGGCATTCGATGGTTATAAATCATTACTTTTTTGCACAAGCTGCTTC
GAATCTTATCATCCCTATTGCCTTATGATTCCAGGAAGATAAGAATATTTCAAAGAAAAA
ATGGAAAGAGCCATGAACAATAGGGAATGGAACTGTCCTAAATGCTAGGTCTGCAAAGTT
TGTAGTAAGGGTCCTAACATTACAAAGAATCTTTTTTGCAGAAAATGTGATGCTATGGTT
CATTTTGAATGTGAATTTAAAGACGTTCAAGTATGGAATGAATCTAAAAATGAACTTTAC
TGGTAGTGCTCAGATTGCTTTAATTGTGCCAAATGTTCGTCAAAATCTTTAATTGATGAA
TCAGATAAACAACTCATGATCAATTTAGATTTTACTGATAACTTTTCATTATGCTACAAA
TGTGGTTTTTTGGACGCTTATTACAGATTCTGTAAATTTTGCAACAAATATTGTAAAAAA
ATACCAACTTTACCTAAGCCCGCTAATTAGCAACCTCTTGATGACCTATTTTAAGAGAAA
AGCGTAAGGCTAAAATATTTAGATTAATATCTTGAAGAAGTTCTGTATCAGTGCAAACTG
TGCTAATAAGTTTACCACAAAAAATGCTTTGAAAAAGCTTATCCAGAATATATTTAGTAG
TTCTTTTGCTATACATGCAAAGACTCAAATCAAAGTTACATGTAAAAGATTTATGAAAAT
AGCTTAATTAGCACTAAGTGTAGGATTATCCATATCCGTAAAGTGTAAGAGTTTCTTCCT
ATAGTTGAGCTAATAATAGAAAAGTAGGCTTAAACTTACAAACTAAACAGGAAAGACATA
GGTGATTTCATAGCAGAATATTTACATTATTTCGAAAGCGATTAATTTGGTATTTATAAA
TAAAATACTATGGCTTATGACAAACTTTGTTAACAACTAAGAGATGAAGGAATTCTGATA
ACACCTTATAACATTAAATAAATGGCTATATATGATGAAAAGGTTATTTCACAAACAATA
GAGCAACTAAAAAATAAAAAATCATTTTGGAGAGACACATATATCTAATCCAATTAATTT
TATTATAAATCAGAATAAATTTATTCAATAGCTTACTTAGATTTGTATAAAAGAGGAATA
ACAGCTCCAGAAACAGCAGAAATTGCATATAAATTTTCATTCGAATCTAATGAAGGCGTA
TTTAGACAACTTCAGTATAGCATTTTCAAATTTGAGTTAAAAGAATCAATCAGATATGAT
TACAGATATGATGAAAATGGATAATTAGAAGTTATTTTTATTGAAAATGATAGAAGACAT
CCTCTTCATTTCATAAAAGAGGATTAATTTTAAGTATTTTAACAGAAAGTACAACAAGTT
ATTAGAGAAAGGGGACTATCAAATCAAAGCTCATCTTAAGCTATATAATTCCCTTCAAGA
GATGGATCTAATTAACCTATGGAAATAGAAGATAGTAACCAACCTAGTGAATAATTAATA
CCAATTGCACCTGTTAAATTATCTTAAAATAGATTTTAGCTTTCTCTCGTTTACTCTTCA
TACTTTAATCAAACAATACTTGACTTATAAATGAAAATTTAATAAGAAAATAGCCAATAT
TAAAAATGTTTTAAAACATATATTAACATTCCTATATTAGAAGAAAAGAGCACTGTTTAA
TTATCGACTGTTACTGGAATAAATAAAAGAAGGGATATTGCTTAGTGTATAATCTTATTG
CAAGCTTAAGAAGAATAACTTGTTGCTTCTGTTAGACAAATGCTTGATGAGTTTATGGAA
AAGAAAAAAGATAAAACTAAGATATCTCTTACTCAATAAGTTTTAAATTCATATCAAAAT
TTTTCTAAGAGTATACTTGGATCTGTTTATTAAACACCTATGTCATATTAAGAAATCATC
AATTAATTCAGAGAAGCTTAGAAAAAATTAATTCTTGTTGATAATAATATAATCGATGAT
CCTATGAGAGAAATACCTTGCTAGTTATGCTCTCTAAAAGGTACAAGAAAAATGTGTGGA
AGGCTTCTCAATTTCGATGTTGATAAATGGGTTCATGCTAATTGTGCTCTTTGGAGTACA
GAAGTTAAAGAAAATATAGATGGTGCTCTAAAAAATTTCATACCAGCTTACAAAAAGTCT
CTATAAGTGTAATGTAAACATTGTAATAAATTTGGAGCCACTATCTCTTGTATGATAGCT
AGTTGCAAAGATAAGTACCATTTCCCTTGTTTATTGAAATCAAATGGTTTTATGACAGAT
CAAAAAACCGTTCTTTGCAAGAGCTGTTGGGATATAATCCTTAAAAACGATGACACTGAA
ATTATTTTAAAAATGCAATATTTAAAATTGGTCAACAATTTTAACACAGATAGAAGAATT
TTTATATCACTTACAAAATAAGAAGGAGGAAACATCGATTTTAGTGGAGAGTGCTATAAT
AGATTTGGTTCTTTTATACTTGTCAATCTTGACACACAAGAAACAAATGATGATGAATTT
TTCTCATCTTATTTCTTTATGAGATACATTAGACCTTTTGTTTCACAAAAATATCAGTCT
TATGTTACTGCATTTTGGTTGAAAAAAAAGAAAGATGAATATATTTTAAAATCTTGTTTG
CTTGCAGAAACTAACAAAATATTTTCATAGACAAAAAATATTGATGAAAACAAAAATGAA
TTTTCAATAGAAAAAGATAGACCATTCACTAATGAATTAAGTGCCAACATAAAAAATTTA
GCAGGATATAAAGAAATAAGCGAATCAAACAATAATATACCTAGATTTACTAACAATGTA
TTGAAAGATAAAGATATATTTAATCATGACCAACTTGATTGCTTCACTTCATTAAAAGGT
ATACAATAGCTCCTCTAAGAAAAGATAAATTAAATATACTAAAGATACAAGGGTGATTAA
CCTAATAAAAGTACTGATGTTAACAAATTTGTTATGGAATACATTGGTTTTGGTATTCCT
CAAATAGTCAAAGCTTGCTAATAGTCTTCAAAATAAAATAAAAATAACAATATATTCTAG
AACATTTAAAATATCAAAGTAAACTCGTTTTAAGAGCTCTTTTACAAAGAGTAAGTAGAA
AATTTTAACCCATTTGAAAAGTAGAAACTATTAGAAAAAATGCATCCCACAATCATGTAA
AATTAAAAATAGTAACAATAATTACAAAACTTAGGATAGTAATAAATGAATTCAAAAGAA
AATTAGTAGTCTTCACATTTAAATATTCCAATTTTACAGCATTTAAGTAATAAAAAATAA
GGTTTTGTCCACTTCCAAAAGCAGAGCTAGAAACCTATTATGGGAAATAATTATTTCATC
AGACCCGATGATATTATGCTAGAAGCTAATCCCGATTACATGAAATAAGATACTCGTTAA
ACGATAAGAGAAAAAGAAATAGAAAAAAAGATTAAAGCAGAATATCCGAATTACATAAAT
AGCAAAAAGAGACATCTAAATATTTATGCTGGTCCTTCTAAAATTCACAAATATGGGTTA
TTTGCAAAAACTTACTTTAAATAAGACGATATTGTTGTTGAATATCTTGGTGAAACAATT
AGATAAGTTCTTGCAGACTATAGAGAGAAGATATACAAATAAAGAGGTTTTGGAGATTGC
TATATGTTCAAAGCATGCCCTGATAAAATTATTGATGCCACTTTTAAAGGGAATGAAGCC
AGATACTTAAATCACTCTTGCAATCCAAATTGCTCCAGTTTAGTTATTGAATACGAAAAA
GATTCAAAAATCATAATTTATGCAAAGAGAGATATAAAACCTGGAGAGGAGCTTACATAT
GATTACTGCTTTGATATAGAAGAAGAGAAGATTAACTGTAACTGCAATGATCCTAATTGC
ACAAGAATAATGAATTGA


>TTHERM_01309130(protein)
MDQRDQIQISLKDYAELIENRKRVLRSNTNTGSSNQQQPAQNNTSSQATTSINDRKNDKS
SKIKKGSVQDEEPDIQKKIKISDQDNLDKSNQSSTNSENQKSSLNSAANQNIQSIQNDEV
FEEIFKKFVDLERDAFLDIPELNSTLHGQFYLKDMNKIDAPYLQDSFVKVYSESQNLITI
SNGYVQQGANKKKKRFMTIQSQKESKTFTQVCDCSKQDILILQNIACLSMDHQSFLKHIR
PNEKSVYQFSDFADPNINQVLWPVVLLSCYGPLKDNIRDLFTNDSYTINDTWDIFKFGNY
RKDSALDEQNDENKLKGQKEKDKNFESQMNIESLSQINFPSQQQIPLQRSLSVQYQQNDV
LIWFIGTNRYSIVNMSQLMKVEDMNKEFVKEIFKKTKLRDITKTLVDLIKSYNQVTNRNK
EFVITAENCKQMIHRIVKIRNNKQFKKKAPQVTSNDDFYYAVILRFQENRQKQTMQLLIK
NLETSKLHWINLNQSERNIITSLNIPALGPQELKFNYYLDIQQKESINPKEIALSFINRF
LLRWFYEKSAITPLRDAEVDRLLQQSIREKEFYTFENMPEKKRNKERCTVCKYILYNLEF
KGCFYCGAYYHTQCILQEEDNRNQHFACDTCEPCSICHGKITDDNITCCECKTHFHKKCG
FSIAYDMNTSDKQIMRWYCESCVQCCICNNKLSDFQNGYSFKDDQIYCNDCNEQLQKKEY
CPICKKFWSQETNKDMVQCTCAMWIHRACDPILKDDKLYDEYKNNLRQQYRCTNCRKRVR
RVLMCQFIKVLSHLDFQKFFTKNEFEKIPNYLKLIKKPIDLYMMQRKAISGDYDNEPYEQ
LYKDFLLLIQNALNFNAHHPEAYREATKLNLLGRTAFQYFQNLLKIDEKELITMTEKTSI
QGKQVEFIKYVEQNFLNIVFSASAQANKSLTTIEIYNKQSERQQSNQSQIIEEPIQNKRE
QENSAQYQEYLRDVQKMEENNIKQFKYTEVSNLVEQGDAIYNYLSFLQQLMNESNQIIVK
FEDICKIFEHIASKGKNEIKYIQSVLKNETLNKIVKYNQYLNDLMNNNTLDESNEQNQLD
NAQSDNSSQEGGVSSQFISFHHALKLEIENFIQKGKPFSFYECVPVKFTNQNINLLRQSC
CFMCGAFDGYKSLLFCTSCFESYHPYCLMIPGRQEYFKEKMERAMNNREWNCPKCQVCKV
CSKGPNITKNLFCRKCDAMVHFECEFKDVQVWNESKNELYWQCSDCFNCAKCSSKSLIDE
SDKQLMINLDFTDNFSLCYKCGFLDAYYRFCKFCNKYCKKIPTLPKPANQQPLDDLFQEK
SVRLKYLDQYLEEVLYQCKLCQQVYHKKCFEKAYPEYIQQFFCYTCKDSNQSYMQKIYEN
SLISTKCRIIHIRKVQEFLPIVELIIEKQAQTYKLNRKDIGDFIAEYLHYFESDQFGIYK
QNTMAYDKLCQQLRDEGILITPYNIKQMAIYDEKVISQTIEQLKNKKSFWRDTYIQSNQF
YYKSEQIYSIAYLDLYKRGITAPETAEIAYKFSFESNEGVFRQLQYSIFKFELKESIRYD
YRYDENGQLEVIFIENDRRHPLHFIKEDQFQVFQQKVQQVIRERGLSNQSSSQAIQFPSR
DGSNQPMEIEDSNQPSEQLIPIAPVKLSQNRFQLSLVYSSYFNQTILDLQMKIQQENSQY
QKCFKTYINIPILEEKSTVQLSTVTGINKRRDIAQCIILLQAQEEQLVASVRQMLDEFME
KKKDKTKISLTQQVLNSYQNFSKSILGSVYQTPMSYQEIINQFREAQKKLILVDNNIIDD
PMREIPCQLCSLKGTRKMCGRLLNFDVDKWVHANCALWSTEVKENIDGALKNFIPAYKKS
LQVQCKHCNKFGATISCMIASCKDKYHFPCLLKSNGFMTDQKTVLCKSCWDIILKNDDTE
IILKMQYLKLVNNFNTDRRIFISLTKQEGGNIDFSGECYNRFGSFILVNLDTQETNDDEF
FSSYFFMRYIRPFVSQKYQSYVTAFWLKKKKDEYILKSCLLAETNKIFSQTKNIDENKNE
FSIEKDRPFTNELSANIKNLAGYKEISESNNNIPRFTNNVLKDKDIFNHDQLDCFTSLKG
IQQLLQEKINQIYQRYKGDQPNKSTDVNKFVMEYIGFGIPQIVKACQQSSKQNKNNNIFQ
NIQNIKVNSFQELFYKEQVENFNPFEKQKLLEKMHPTIMQNQKQQQQLQNLGQQQMNSKE
NQQSSHLNIPILQHLSNKKQGFVHFQKQSQKPIMGNNYFIRPDDIMLEANPDYMKQDTRQ
TIREKEIEKKIKAEYPNYINSKKRHLNIYAGPSKIHKYGLFAKTYFKQDDIVVEYLGETI
RQVLADYREKIYKQRGFGDCYMFKACPDKIIDATFKGNEARYLNHSCNPNCSSLVIEYEK
DSKIIIYAKRDIKPGEELTYDYCFDIEEEKINCNCNDPNCTRIMN


>TTHERM_01309130(gene)
ATGGATTAAAGAGATTAAATTCAGATTTCATTAAAGGACTACGCAGAGCTTATAGAAAAT
CGTAAAAGAGTACTAAGAAGTAATACTAACACTGGTAGCAGCAATCAGCAATAACCAGCT
TAAAATAATACTTCGTCTTAAGCAACAACTTCAATCAATGATGTAAAAAATTTATATTAA
AAATTTCAATTGTCTATAAGCATTTGTGCACCTTTAAAAAATAGAGGAAGAATGATAAAA
GCTCTAAAATTAAAAAGGGAAGCGTATAAGATGAAGGTAATTTAGCTAAAATAACCTATT
TCTTGATTTTATTGTGAAAATATTTTTATAAACGGATATAATATTTTATTTTTATGCTTT
TAATTGTCCAATAATTTAAAGCAAGCAGTAGGATTGATCTGTTTTTTTTAAAAAATATAG
AACCAGATATTTAAAAGAAAATAAAAATAAGCGATTAAGACAACTTAGATAAGTCTAATC
AAAGCAGCACTAATAGTGAAAATTAAAAGAGTAGTTTGAACTCTGCTGCAAATTAGAATA
TTTAATCTATTTAGAATGATGAAGTGTTTGAAGAGATATTTAAAAAGTTTGTAGATTTAG
AGCGCGATGCTTTTTTGGACATCCCAGAGTTAAATAGCACTTTACATGGATAGTTTTATT
TAAAAGATATGAATAAAATAGACGCTCCTTATTTATAAGATTCTTTTGTTAAAGTTTATT
CTGAATCATAAAATTTGATTACTATTTCAAATGGATATGTCTAGCAAGGAGCTAATAAAA
AGAAAAAGAGGTTTATGACAATTTAGTCACAAAAAGAATCTAAAACTTTTACATAAGTAT
GTGACTGCTCTAAACAAGATATATTAATACTTTAAAATATAGCATGTCTATCTATGGATC
ATTAATCATTTTTAAAGCACATAAGACCTAATGAAAAATCAGTATATTAATTTAGCGATT
TTGCAGATCCAAACATTAATTAAGTGTTATGGCCTGTTGTTTTACTATCTTGTTATGGAC
CCCTTAAGGATAACATTAGGGATTTATTTACAAATGATTCTTATACTATTAATGATACTT
GGGATATCTTTAAATTTGGTAATTATCGAAAGGATTCTGCTTTAGATGAGTAAAATGATG
AAAGTAAATTAAAATTTAGCTAAATTGATATTTTTCCTATTTTATCATTTGAGTTTATTA
TTTCTTTCGTTAATTGTGTTAAAATATTTTATTGAATAATTTTTTATATTCGTATTTATA
GATAAATTAAAAGGCTAAAAGGAAAAGGATAAAAATTTTGAAAGCCAAATGAATATAGAG
TCACTCTCTTAAATAAATTTCCCTTCATAATAGCAAATCCCTCTTTAAAGAAGTTTATCT
GTTTAATATTAATAAAACGATGTTCTTATATGGTTTATTGGCACTAATAGATATTCTATG
TAATCTTCTTATAATGATTTATTTTTTTTATCAAAACTAACTATTGTAATTACTTTAAAT
TTTTTTTTTTTTCCCTTTATATTATAGAGTAAATATGTCTCAGCTTATGAAAGTGGAAGA
TATGAATAAAGAATTTGTGAAGGAAATTTTTAAAAAGACCAAATTAAGGGATATTACAAA
AACTCTTGTTGATTTAATTAAATCTTATAACCAGGTTACAAATAGGAACAAAGAATTTGT
CATCACGGCTGAAAACTGTAAATAAATGATCCATCGTATTGTCAAAATAAGAAATAATAA
GCAATTCAAAAAAAAAGCTCCTCAAGTGACTTCAAATGATGATTTTTATTATGCAGTCAT
TTTAAGATTTTAAGAAAATAGATAAAAATAAACAATGCAGCTTTTAATTAAGAACTTAGA
AACTTCCAAACTTCATTGGATTAATCTAAATTAATCAGAAAGAAATATTATAACCTCACT
AAATATCCCAGCTCTTGGTCCTCAAGAATTAAAGTTTAACTACTATCTTGATATTTAGTA
AAAGGAATCTATTAATCCGAAAGAAATTGTAATTTAAAGTTTAATCTTATTTAATCATGC
TTATTATTCTTATTGAAAAAGGCTCTTTCATTCATCAATAGATTTTTGTTGAGATGGTTT
TATGAAAAAAGTGCAATAACACCTTTAAGAGACGCAGAAGTAGACAGACTTTTATAATAA
TCTATTAGGGAAAAAGAATTTTACACTTTCGAAAATATGCCAGAAAAAAAAAGAAACAAA
GAGCGTTGCACTGTTTGTAAATACATTTTGTATAATTTGGAATTTAAAGGTTGCTTTTAT
TGTGGAGCATATTATCACACTCAATGCATTCTCTAAGAAGAGGATAACCGTAACTAGCAT
GTAACTTTTTTAATATTTAAGTTGTATTTGTAAATATTTTTTAAATTAGTTTGCATGTGA
TACTTGTGAGCCATGTAGTATTTGCCACGGGAAAATAACTGATGATAATATTACATGCTG
TGAGTGTAAAACTCACTTTCACAAAAAGTGTGGTTTCTCAATAGCTTATGATATGAATAC
AAGTGATAAATAAATTATGAGGTGGTATTGCGAATCTTGTGTTTAATGCTGTATTTGTAA
TAATAAGCTATCTGATTTTCAAAATGGATATTCGTAATTTACTAAATAATATTTAAAGTT
TATTTAAATAAATTATTTATTTTAATTTATAGTTTTAAAGATGATTAAATTTACTGCAAT
GATTGTAATGAGCAGCTTTAAAAGAAAGAGTATTGCCCTATTTGTAAAAAATTTTGGTCT
TAAGAAACTAACAAAGATATGGTTCAGTGTACTTGTGCTATGTGGATTCATAGAGCATGT
GATCCGATTTTAAAAGATGATAAACTTTATGATGAATATAAAAACAATTTAAGGCAATAA
TATCGTTGCACTAATTGTAGAAAAAGAGTTAGAAGAGTTTTAATGTGTCAATTTATAAAA
GTTCTTTCACAGTAAATTTTACAATATTTTTATATGTAATAAATATGTTTATAAAAATTA
ATATTATTAGTTTAGATTTTTAGAAATTTTTTACCAAGAATGAGTTTGAAAAAATACCTA
ACTACCTCAAGCTTATAAAGAAGCCCATAGATTTATATATGATGCAGAGAAAAGCAATCT
CTGGCGATTATGATAATGAACCATATGAGCAACTTTACAAGGACTTCTTGCTTCTCATAT
AAAATGCACTGAATTTTAATGCTCATCATCCAGAAGCTTATAGAGAGGCCACAAAATTAA
ATTTACTAGGGAGAACTGCATTTTAATATTTTTAAAATCTTTTAAAAATTGATGAAAAAG
AGCTGATAACAATGACTGAAAAAACATCTATTTAAGGAAAACAAGTCGAATTCATTAAAT
ATGTTGAATAAAACTTCTTAAATATTGTATTTAGCGCCTCTGCTTAAGCAAATAAATCGC
TAACCACTATTGAAATCTATAACAAATAAAGTGAGAGTAAGATATATTTAAATTTTTTTT
TGATGTTTATCTGCTTTATAAAAAGGACAACAATCTAATTAGAGTTAAATAATTGAAGAA
CCAATTCAAAATAAAAGAGAACAAGAAAATTCTGCTTAATATTAAGAATATTTGAGAGAT
GTTTAAAAAATGGAAGAAAATAATATTAAATAATTTAAATACACTGAAGTTAGTAATTTA
GTTGAGTAAGGAGATGCCATATATAACTATCTATCTTTCCTTTAACAATTGATGAACGAA
TCCAACTAAATTATTGTAAAATTTGAAGATATTTGTAAGATATTTGAGCATATTGCTTCG
AAAGGTAAAAACGAAATAAAATACATCTAATCAGTTTTAAAAAATGAAACTTTAAACAAA
ATTGTTAAATACAACCAATATTTAAATGATCTCATGAACAACAATACTCTTGATGAATCG
AATGAATAAAATTAATTGGATAATGCACAGTCAGATAATTCTTCCTAAGAAGGAGGGGTT
TCAAGTTAATTTATTTCATTCCATCATGCTTTGAAATTAGAAATTGAAAACTTCATATAA
AAAGGTTTGAATTTTTTTTATTCATTTAAAATTTTTTTATTTAGATATTTATAAATATAA
AGGTAAACCATTTAGCTTTTATGAATGCGTGCCTGTAAAATTTACAAATCAAAATATCAA
TTTGCTACGATAAAGTTGTTGCTTTATGTGTGGGGCATTCGATGGTTATAAATCATTACT
TTTTTGCACAAGCTGCTTCGAATCTTATCATCCCTATTGCCTTATGATTCCAGGAAGATA
AGAATATTTCAAAGAAAAAATGGAAAGAGCCATGAACGTAATAATTTTATTATTTACATT
TTTTTATAAAATTTATCTCCAGAATAGGGAATGGAACTGTCCTAAATGCTAGGTCTGCAA
AGTTTGTAGTAAGGGTCCTAACATTACAAAGAATCTTTTTTGCAGAAAATGTGATGCTAT
GGTTCATTTTGAATGTGAATTTAAAGACGTTCAAGTATGGAATGAATCTAAAAATGAACT
TTACTGGTAGTGCTCAGATTGCTTTAATTGTGCCAAATGTTCGTCAAAATCTTTAATTGA
TGAATCAGATAAACAACTCATGATCAATTTAGATTTTACTGATAACTTTTCATTATGCTA
CAAATGTGGTTTTTTGGACGCTTATTACAGATTCTGTAAATTTTGCAACAAATATTGTAA
AAAAATACCAACTTTACCTAAGCCCGCTAATTAGCAACCTCTTGATGACCTATTTTAAGA
GAAAAGCGTAAATTAAAATAAACACATTTAATAAATTAAATTTGATTAACTTAAAAGGTA
AGGCTAAAATATTTAGATTAATATCTTGAAGAAGTTCTGTATCAGTGCAAACTGTGCTAA
TAAGTTTACCACAAAAAATGCTTTGAAAAAGCTTATCCAGAATATATTTAGTAGTTCTTT
TGCTATACATGCAAAGACTCAAATCAAAGTTACATGTAAAAGATTTATGAAAATAGCTTA
ATTAGCACTAAGTGTAGGATTATCCATATCCGTAAAGTGTAAGAGTTTCTTCCTATAGTT
GAGCTAATAATAGAAAAGTAGGCTTAAACTTACAAACTAAACAGGAAAGACATAGGTGAT
TTCATAGCAGAATATTTACATTATTTCGAAAGCGATTAAGTAAGCTCATTTTTGGAAAAT
TATGCAAATAATTAATTTTTTTAAAACTAGTTTGGTATTTATAAATAAAATACTATGGCT
TATGACAAACTTTGTTAACAACTAAGAGATGAAGGAATTCTGATAACACCTTATAACATT
AAATAAATGGCTATATATGATGAAAAGGTTATTTCACAAACAATAGAGCAACTAAAAAAT
AAAAAATCATTTTGGAGAGACACATATATCTAATCCAATTAATTTTATTATAAATCAGAA
TAAATTTATTCAATAGCTTACTTAGATTTGTATAAAAGAGGAATAACAGCTCCAGAAACA
GCAGAAATTGCATATGTAATGATATAAAAATTATTTACTTAATTAAAGTTTTTTTAAAAT
ATAAACATTTAAGGCATCTTATTTTAATTAATTATTAATTTGTTTATATCTTTAAAATAA
ATAATTACTTTTTTAATTAAATTTTAGAAATTTTCATTCGAATCTAATGAAGGCGTATTT
AGACAACTTCAGTATAGCATTTTCAAATTTGAGTTAAAAGAATCAATCAGATATGATTAC
AGATATGATGAAAATGGATAATTAGAAGTTATTTTTATTGAAAATGATAGAAGACATCCT
CTTCATTTCATAAAAGAGGATTAATTTTAAGTATTTTAACAGAAAGTACAACAAGTTATT
AGAGAAAGGGGACTATCAAATCAAAGCTCATCTTAAGCTATATAATTCCCTTCAAGAGAT
GGATCTAATTAACCTATGGAAATAGAAGATAGTAACCAACCTAGTGAATAATTAATACCA
ATTGCACCTGTTAAATTATCTTAAAATAGATTTTAGCTTTCTCTCGTTTACTCTTCATAC
TTTAATCAAACAATACTTGACTTATAAATGAAAATTTAATAAGAAAATAGCCAATATTAA
AAATGTTTTAAAACATATATTAACATTCCTATATTAGAAGAAAAGAGCACTGTTTAATTA
TCGACTGTTACTGGAATAAATAAAAGAAGGGATATTGCTTAGTGTATAATCTTATTGCAA
GCTTAAGAAGAATAACGTAAATTTAAAAACTATTAGATTTCAGAAATTTTATTTTATTAA
AATTTAAGTTGTTGCTTCTGTTAGACAAATGCTTGATGAGTTTATGGAAAAGAAAAAAGA
TAAAACTAAGATATCTCTTACTCAATAAGTTTTAAATTCATGTAAATTAATAGTTAATTA
TAATAAATATTCATTAAATTAAAAAAATTAGATCAAAATTTTTCTAAGAGTATACTTGGA
TCTGTTTATTAAACACCTATGTCATATTAAGAAATCATCAATTAATTCAGAGAAGCTTAG
AAAAGTAAATTTTATATAAAATAATCAATTAATAAAACACCATAAATTTATAGAATTAAT
TCTTGTTGATAATAATATAATCGATGATCCTATGAGAGAAATACCTTGCTAGTTATGCTC
TCTAAAAGGTACAAGAAAAGTAAGATATTTATTTATTTAATTATTATCTACCGTGGGTAC
GCATGAATAAGGATTATCAAAAAAAAAATCTTTTTTAAAATTTCTTATCCTTTTTAATCC
TTATTTTAAATTCATCCTTATTCAAAAATTATCCTTATTCATGCGTACCCACGGTATTTC
AAATTTTAATGTTTTATGAAAAATTATATTAGATGTGTGGAAGGCTTCTCAATTTCGATG
TTGATAAATGGGTTCATGCTAATTGTGCTCTTTGGAGTACAGAAGTTAAAGAAAATATAG
ATGGTGCTCTAAAAAATTTCATACCAGCTTACAAAAAGTCTCTATAAGTGGTATCATTAA
TTGATTGTTAACTCTTTTTTAATTAGATACTAATTTTATTTAACTTAAAGTAATGTAAAC
ATTGTAATAAATTTGGAGCCACTATCTCTTGTATGATAGCTAGTTGCAAAGATAAGTACC
ATTTCCCTTGTTTATTGAAATCAAATGGTTTTATGACAGATCAAAAAACCGTTCTTTGCA
AGAGCTGTTGGGATATAATCCTTAAAAACGATGACACTGAAATTATTTTAAAAGTAAAAA
TAATTAATTAATTTTACTTTTACTATTTTAAGCGATTCATAAAAATAAAATAATATTTTT
AAATAGATGCAATATTTAAAATTGGTCAACAATTTTAACACAGATAGAAGAATTTTTATA
TCACTTACAAAATAAGAAGGAGGAAACATCGATTTTAGTGGAGAGTGCTATAATAGATTT
GGTTCTTTTATACTTGTCAATCTTGACACACAAGAAACAAATGATGATGAATTTTTCTCA
TCTTATTTCTTTATGAGATACATTAGACCTTTTGTTTCACAAAAATATCAGTCTTATGTA
AATTTTTAAAATAAATTTTTTTAAAAACAAGGCTTATATTATTTATTTGAGTGCCTGCTT
TTAATTGATAGTAAATTTTATTATAAAATAAATAAATAAGGTTACTGCATTTTGGTTGAA
AAAAAAGAAAGATGAATATATTTTAAAATCTTGTTTGCTTGCAGAAACTAACAAAATATT
TTCATAGACAAAAAATATTGATGAAAACAAAAATGAATTTTCAATAGAAAAAGATAGACC
ATTCACTAATGAATTAAGTGCCAACATAAAAAATTTAGCAGGATATAAAGAAATAAGCGA
ATCAAACAATAATATACCTAGATTTACTAACAATGTATTGAAAGATAAAGATATATTTAA
TCATGACCAACTTGATTGCTTCACTTCATTAAAAGGTATACAATAGCTCCTCTAAGAAAA
GATAAATTAAATATACTAAAGATACAAGGGTGATTAACCTAATAAAAGTACTGATGTTAA
CAAATTTGTTATGGAATACATTGGTTTTGGTATTCCTCAAATAGTCAAAGCTTGCTAATA
GTCTTCAAAATAAAATAAAAATAACAATATATTCTAGAACATTTAAAATATCAAAGTAAA
CTCGTTTTAAGAGCTCTTTTACAAAGAGTAAGTAGAAAATTTTAACCCATTTGAAAAGTA
GAAACTATTAGAAAAAATGCATCCCACAATCATGTAAAATTAAAAATAGTAACAATAATT
ACAAAACTTAGGATAGTAATAAATGAATTCAAAAGAAAATTAGTAGTCTTCACATTTAAA
TATTCCAATTTTACAGCATTTAAGTAATAAAAAATAAGGTAAATTTATTTTAGCTAATTA
AGTTTTTGTTGTTTTAATCTAATAAATTAAATTAGGTTTTGTCCACTTCCAAAAGCAGAG
CTAGAAACCTATTATGGGAAATAATTATTTCATCAGACCCGATGATATTATGCTAGAAGC
TAATCCCGATTACATGAAATAAGATACTCGTTAAACGATAAGAGAAAAAGAAATAGAAAA
AAAGATTAAAGCAGAATATCCGAATTACATAAATAGCAAAAAGAGACATCTAAATATTTA
TGCTGGTCCTTCTAAAATTCACAAATATGGGTTATTTGCAAAAACTTAGTAATTAATATA
TTTTCTTATTTATATGATTTCAATGTTCAAAAATTAATTAATTGTGTTATTTATTTCTAT
TAGCTTTAAATAAGACGATATTGTTGTTGAATATCTTGGTGAAACAATTAGATAAGTTCT
TGCAGACTATAGAGAGAAGATATACAAATAAAGAGGTTTTGGAGATTGCTATATGTTCAA
AGCATGCCCTGATAAAATTATTGATGCCACTTTTAAAGGGAATGAAGCCAGATACTTAAA
TCACTCTTGCAATGTAAATATTTCAAAAAATATTTTATTTTTATTAATTTACTTTTAAAA
AGCCAAATTGCTCCAGTTTAGTTATTGAATACGAAAAAGATTCAAAAATCATAATTTATG
CAAAGAGAGATATAAAACCTGGAGAGGAGCTTACATATGATTACTGCTTTGATATAGAAG
AAGAGAAGATTAACTGTAACTGCAATGATCCTAATTGCACAAGAATAATGAATTGA