Identifiers and Description

Gene Model Identifier

TTHERM_001044369

Standard Name

MLH3 (previously annotated as TTHERM_01044360)

Aliases

None

Description

Homologue of budding yeast MLH3. transmembrane protein putative

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_001044369

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

No Data fetched for Homologs

General Information

Paragraph NoGene NameParagraph Text
101MLH3Referred to by the previous annotation (TTHERM_01044360) in the paper, pubmed ID: 25217051.

Associated Literature

  1. Ref:25217051: Shodhan A, Lukaszewicz A, Novatchkova M, Loidl J (2014) Msh4 and Msh5 function in SC-independent chiasma formation during the streamlined meiosis of Tetrahymena. Genetics 198(3):983-93

Sequences

>TTHERM_001044369(coding)
ATGATTTTAAACAAAAAATTCTTGAAAATGATTATTAGGATATATCCCTGGCTGATAGAA
ATTAAAATTTTAATCAATAAATTTAAATTTTTTCAAAACAAAGTAATGAAGAAGTACAGT
AAATATCTTAAGTTTCAAAACTAGATAGAACTATTTTTGAAGACATAGAAATATTTGGAA
ATTGTAACAATAAAGTAATTATTTGCTTTAATTAGTAGAAAGGAATGCTTTTCGGGTTAG
ATTAGCATGCAATACATGAGAGAATAAGATATGAATATTTTTGTAATTAATTCAAAGCAT
CTGCTTTTTGCTTGTAATACAAATAAAGCAGAAATGAAATAGACTCTAAATGCATCAATT
TATCATAGCGAAATAAAGATAAGCAATTTCCATCTATACTCTGGTTTGACCAAACAAGAA
CAAATTGTTTAGAATTAGATGCTTATATTTTTTAAAGGCTTTAAAAGAATGTTGATAAGT
TAAGTTAATTCAAAATATAAGTTGTAAAAATTTAAAATATTAATTAAAATAAATTTGAAG
TCTATTTATGGCCTTAGTTATATATCCTTAATAAGCCTATTACTTATGATCTTAAATTTA
TAGATTCAATATTAAACTCAGAGCTCGGTCATATACCTAATACAATTGATGAAATAATAA
TGTCTAAAGCATGTAAGGGAGCGATTAAATTTAATGAAGAACTCAATTAAAATTAGATGG
ATATGTTAATAAAAAATATTAAATTATGTGAGTTTCCTTTTTACTGTGTGCATGGCAGAA
GCTCAATACATCCATTTTTTTCCTTAGAAATACAAGACGTTTGCTAGATCTAAAAAAATT
ATCAAATTTGAATTTTTAATTGCATACAGACAAACTTAAATAAATTTTCTTGAATAAAAA
AGATTTTACAAATAAGACATTAAATATTATTTTAACTTTTTATTGCAGCAATCAACATAA
ATCTTGTAAAATTCGAAAATATTTTTATATATTTAAGAGAATTTTTTTAAAATTATAATG
ATTATTGTTTAAATTAAAATTATTTATTTTTTCACCAACTTTTGA


>TTHERM_001044369(protein)
MILNKKFLKMIIRIYPWLIEIKILINKFKFFQNKVMKKYSKYLKFQNQIELFLKTQKYLE
IVTIKQLFALISRKECFSGQISMQYMREQDMNIFVINSKHLLFACNTNKAEMKQTLNASI
YHSEIKISNFHLYSGLTKQEQIVQNQMLIFFKGFKRMLISQVNSKYKLQKFKILIKINLK
SIYGLSYISLISLLLMILNLQIQYQTQSSVIYLIQLMKQQCLKHVRERLNLMKNSIKIRW
ICQQKILNYVSFLFTVCMAEAQYIHFFPQKYKTFARSKKIIKFEFLIAYRQTQINFLEQK
RFYKQDIKYYFNFLLQQSTQILQNSKIFLYIQENFFKIIMIIVQIKIIYFFTNF


>TTHERM_001044369(gene)
ATGATTTTAAACAAAAAATTCTTGAAAATGATTATTAGGATATATCCCTGGCTGATAGAA
ATTAAAATTTTAATCAATAAATTTAAATTTTTTCAAAACAAAGTAATGAAGAAGTACAGT
AAATATCTTAAGTTTCAAAACTAGATAGAACTATTTTTGAAGACATAGAAATATTTGGAA
ATTGTAACAATAAAGTAATTATTTGCTTTAATTAGTAGAAAGGAATGCTTTTCGGGTTAG
ATTAGCATGCAATACATGAGAGAATAAGATATGAATATTTTTGTAATTAATTCAAAGCAT
CTGCTTTTTGCTTGTAATACAAATAAAGCAGAAATGAAATAGACTCTAAATGCATCAATT
TATCATAGCGAAATAAAGATAAGCAATTTCCATCTATACTCTGGTTTGACCAAACAAGAA
CAAATTGTTTAGAATTAGATGCTTATATTTTTTAAAGGCTTTAAAAGAATGTTGATAAGT
TAAGTTAATTCAAAATATAAGTTGTAAAAATTTAAAATATTAATTAAAATAAATTTGAAG
TCTATTTATGGCCTTAGTTATATATCCTTAATAAGCCTATTACTTATGATCTTAAATTTA
TAGATTCAATATTAAACTCAGAGCTCGGTCATATACCTAATACAATTGATGAAATAATAA
TGTCTAAAGCATGTAAGGGAGCGATTAAATTTAATGAAGAACTCAATTAAAATTAGATGG
ATATGTTAATAAAAAATATTAAATTATGTGAGTTTCCTTTTTACTGTGTGCATGGCAGAA
GCTCAATACATCCATTTTTTTCCTTAGAAATACAAGACGTTTGCTAGATCTAAAAAAATT
ATCAAATTTGAATTTTTAATTGCATACAGACAAACTTAAATAAATTTTCTTGAATAAAAA
AGATTTTACAAATAAGACATTAAATATTATTTTAACTTTTTATTGCAGCAATCAACATAA
ATCTTGTAAAATTCGAAAATATTTTTATATATTTAAGAGAATTTTTTTAAAATTATAATG
ATTATTGTTTAAATTAAAATTATTTATTTTTTCACCAACTTTTGA