Identifiers and Description

Gene Model Identifier

TTHERM_00471820

Standard Name

MLH1 (Micronuclear Linker Histone )

Aliases

PreTt22590 | 56.m00294 | 3686.m00137

Description

Micronuclear linker histone polyprotein; contains linker histone peptides alpha, beta, delta and gamma; sequence not similar to typical histone H1; present in single copy in haploid genome

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( PF00505 ) HMG (high mobility group) box

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10%

TetraMine Data

TTHERM_00471820

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_11263.19.99838497179609e-146HMG box family protein (605 aa
)

General Information

Paragraph NoGene NameParagraph Text
8HHO1,
MLH1
The HHO1 gene encodes the macronuclear linker histone H1 protein; the MLH1 gene encodes a polyprotein comprising a set of four micronuclear linker histone proteins (alpha, beta, gamma, and delta) unrelated to Hho1p. Histone H1 and the MLH proteins are chromatin proteins that associate with the inter-nucleosomal (linker) DNA. T. thermophila has two nuclei, one of which is transcriptionally active (the macronucleus) and one that is silent during most of the life cycle (the micronucleus). Furthermore, the macronucleus undergoes amitosis, whereas the micronucleus undergoes typical mitosis. The fact that Hho1p and MLH proteins are found exclusively in the macronucleus and micronucleus, respectively, has led to studies of their function, or lack of function, in transcription regulation, mitosis, and amitosis. Surprisingly, an HHO1 knockout showed this gene to be non-essential; its main observable phenotype was an overall decondensation of macronuclear chromatin. MLH1 knockouts, which are also viable, showed a similar phenotype in the micronucleus.

Associated Literature

  1. Ref:8995382: Sweet MT, Carlson G, Cook RG, Nelson D, Allis CD (1997) Phosphorylation of linker histones by a protein kinase A-like activity in mitotic nuclei. The Journal of biological chemistry 272(2):916-23
  2. Ref:8947546: Sweet MT, Jones K, Allis CD (1996) Phosphorylation of linker histone is associated with transcriptional activation in a normally silent nucleus. The Journal of cell biology 135(5):1219-28
  3. Ref:8760889: Liu X, Gorovsky MA (1996) Cloning and characterization of the major histone H2A genes completes the cloning and sequencing of known histone genes of Tetrahymena thermophila. Nucleic acids research 24(15):3023-30
  4. Ref:7606784: Shen X, Yu L, Weir JW, Gorovsky MA (1995) Linker histones are not essential and affect chromatin condensation in vivo. Cell 82(1):47-56
  5. Ref:8264578: Wu M, Allis CD, Sweet MT, Cook RG, Thatcher TH, Gorovsky MA (1994) Four distinct and unusual linker proteins in a mitotically dividing nucleus are derived from a 71-kilodalton polyprotein, lack p34cdc2 sites, and contain protein kinase A sites. Molecular and cellular biology 14(1):10-20

Sequences

>TTHERM_00471820(coding)
ATGAAAGATTTGCTTTTTATAAGTCAACAATAATAACATTAATTAAAATGCGGGTATCTT
TATTTAAAATTCAAAATAAATTATAATCATAAATTTACAAAATATAATTTATTAAAAGAT
TATTAAAAAAAATAATTTGACTCTTAAAAAAAAAAAGATCCTTCAAAAAAAATGGAATTA
AGAACTAAGACATTAAATATTTAACCTCCTAAGAAACCATTTTCTAATACCTATTAAGCT
TTCGTATTAGAAAAGAAGAATGCCTTAGGAAAGAATTTTGATAACAAGAAAGTTTAAGCT
GACTACAACAAATTATCCAATAATGAGAAAGAAAGACTCCAAAAGTTGGTTGATAATGCT
GAAGAGAAGTACAAAGAGGAACTATTCCACTACAACAATCACATCTAGGGAAAAGGTAAA
CAAAAATATGTTCCTTAAGTTAAAGTCCCTGAAAAGCCTAAAAAGCCTATTGGTAGCTTT
TTCCGTTTCCTAGAGGAAAACAGACAAAAGTACGCTGCTAAGCACAAAGACTTAACTAAC
GCTAAAATTTTGAAAATAATGTCAGAAGACTTTAACAATTTACCTCAAAAAGAAGTCAAG
GTATATGAAGATGCTTATTAGAAAGAATACGCTTAATACTTAGTTGAATTCAAGAAGTGG
AATGAAAAGTATGGTTAAGCTGCTCAAAAAAAACAAACTAAAAGAAAGAACTCTACTTCC
AAATCAAGAAGAAGCTCAAGTAAAGGAAAATCTTCTGTTTCTAAAGGAAGAACAAAATCC
ACTTCTTCAAAGAGAAGAGCTGATTCCTCAGCTTCTCAAGGTAGATCTCAATCTTCCTCA
TCAAACAGAAGAAAAGCTTCCAGCTCAAAGGACTAAAAAGGTACCCGCTCTTCAAGCAGA
AAGGCCTCTAATTCTAAAGGAAGAAAGAATTCAACTTCAAATAAAAGAAACTCCTCCTCA
TCTAGCAAAAGATCTTCTTCTTCTAAAAACAAAAAATCATCTTCTTCTAAGAACAAAAAA
TCTTCTTCTTCTAAAGGTAGAAAGTCTTCTTCATCTAGAGGTAGAAAAGCTTCATCTTCT
AAGAACAGAAAATCATCAAAATCAAAAGATAGAAAATCATCTTCCTCAAAAGGTAGAAAA
TCATCATCATCCTCAAAAAGCAATAAGAGAAAGGCTTCCAGTTCTAGAGGTAGAAAATCC
TCAAGCTCAAAGGGAAGAAAATCATCTAAATCATAAGAAAGAAAAAATTCTCATGCTGAT
ACCAGTAAACAAATGGAAGATGAAGGTTAAAAAAGAAGATAATCTAGCAGTTCAGCTAAA
AGAGATGAATCCTCAAAGAAAAGTAGAAGAAACTCTATGAAAGAAGCTAGAACAAAGAAA
GCCAACAATAAATCAGCTTCTAAAGCTTCAAAGAGTGGATCAAAATCCAAAGGTAAAAGT
GCCTCTAAGAGCAAAGGAAAATCATCTTCTAAAGGCAAAAACTCAAAATCTAGAAGTGCC
TCTAAGCCAAAATCAAATGCCGCTTAAAATTCCAACAATACCCATCAAACTGCTGATTCT
AGTGAAAATGCTTCTTCTACTACTCAAACTAGAACTAGAGGAAGACAAAGAGAATAAAAA
GATATGGTTAATGAAAAATCAAATAGCAAATCAAGCTCCAAGGGAAAGAAGAATTCAAAA
TCAAATACAAGATCAAAGTCTAAATCTAAATCTGCTTCTAAATCCAGAAAAAATGCTTCT
AAATCTAAGAAGGATACCACTAATCATGGAAGATAAACTAGATCTAAATCAAGATCTGAG
TCTAAGAGTAAATCTGAAGCTCCTAACAAGAATAGCAATAAGATGGAAGTAATTGAATAA
CCTAAAGAAGAATCCAGTGACAGAAAGAGAAGAGAATCAAGAAGTCAATCTGCTAAAAAA
ACCTCTGATAAGAAATCTAAAAATAGAAGTGACTCTAAGAAGATGACTGCCGAAGATCCT
AAGAAGAACAACGCAGAAGATTCTAAGGGTAAGAAAAAATCCAAAGAAGGAAAGACTGGA
GCTTATGGCAAGAAGGCAAATAAAAAATAATGA


>TTHERM_00471820(protein)
MKDLLFISQQQQHQLKCGYLYLKFKINYNHKFTKYNLLKDYQKKQFDSQKKKDPSKKMEL
RTKTLNIQPPKKPFSNTYQAFVLEKKNALGKNFDNKKVQADYNKLSNNEKERLQKLVDNA
EEKYKEELFHYNNHIQGKGKQKYVPQVKVPEKPKKPIGSFFRFLEENRQKYAAKHKDLTN
AKILKIMSEDFNNLPQKEVKVYEDAYQKEYAQYLVEFKKWNEKYGQAAQKKQTKRKNSTS
KSRRSSSKGKSSVSKGRTKSTSSKRRADSSASQGRSQSSSSNRRKASSSKDQKGTRSSSR
KASNSKGRKNSTSNKRNSSSSSKRSSSSKNKKSSSSKNKKSSSSKGRKSSSSRGRKASSS
KNRKSSKSKDRKSSSSKGRKSSSSSKSNKRKASSSRGRKSSSSKGRKSSKSQERKNSHAD
TSKQMEDEGQKRRQSSSSAKRDESSKKSRRNSMKEARTKKANNKSASKASKSGSKSKGKS
ASKSKGKSSSKGKNSKSRSASKPKSNAAQNSNNTHQTADSSENASSTTQTRTRGRQREQK
DMVNEKSNSKSSSKGKKNSKSNTRSKSKSKSASKSRKNASKSKKDTTNHGRQTRSKSRSE
SKSKSEAPNKNSNKMEVIEQPKEESSDRKRRESRSQSAKKTSDKKSKNRSDSKKMTAEDP
KKNNAEDSKGKKKSKEGKTGAYGKKANKKQ


>TTHERM_00471820(gene)
ATGAAAGATTTGCTTTTTATAAGTCAACAATAATAACATTAATTAAAATGCGGGTATCTT
TATTTAAAATTCAAAATAAATTATAATCATAAATTTACAAAATATAATTTATTAAAAGAT
TATTAAAAAAAATAATTTGACTCTTAAAAAAAAAAAGATCCTTCAAAAAAAATGGAATTA
AGAACTAAGACATTAAATATTTAACCTCCTAAGAAACCATTTTCTAATACCTATTAAGCT
TTCGTATTAGAAAAGAAGAATGCCTTAGGAAAGAATTTTGATAACAAGAAAGTTTAAGCT
GACTACAACAAATTATCCAATAATGAGAAAGAAAGACTCCAAAAGTTGGTTGATAATGCT
GAAGAGAAGTACAAAGAGGAACTATTCCACTACAACAATCACATCTAGGGAAAAGGTAAA
CAAAAATATGTTCCTTAAGTTAAAGTCCCTGAAAAGCCTAAAAAGCCTATTGGTAGCTTT
TTCCGTTTCCTAGAGGAAAACAGACAAAAGTACGCTGCTAAGCACAAAGACTTAACTAAC
GCTAAAATTTTGAAAATAATGTCAGAAGACTTTAACAATTTACCTCAAAAAGAAGTCAAG
GTATATGAAGATGCTTATTAGAAAGAATACGCTTAATACTTAGTTGAATTCAAGAAGTGG
AATGAAAAGTATGGTTAAGCTGCTCAAAAAAAACAAACTAAAAGAAAGAACTCTACTTCC
AAATCAAGAAGAAGCTCAAGTAAAGGAAAATCTTCTGTTTCTAAAGGAAGAACAAAATCC
ACTTCTTCAAAGAGAAGAGCTGATTCCTCAGCTTCTCAAGGTAGATCTCAATCTTCCTCA
TCAAACAGAAGAAAAGCTTCCAGCTCAAAGGACTAAAAAGGTACCCGCTCTTCAAGCAGA
AAGGCCTCTAATTCTAAAGGAAGAAAGAATTCAACTTCAAATAAAAGAAACTCCTCCTCA
TCTAGCAAAAGATCTTCTTCTTCTAAAAACAAAAAATCATCTTCTTCTAAGAACAAAAAA
TCTTCTTCTTCTAAAGGTAGAAAGTCTTCTTCATCTAGAGGTAGAAAAGCTTCATCTTCT
AAGAACAGAAAATCATCAAAATCAAAAGATAGAAAATCATCTTCCTCAAAAGGTAGAAAA
TCATCATCATCCTCAAAAAGCAATAAGAGAAAGGCTTCCAGTTCTAGAGGTAGAAAATCC
TCAAGCTCAAAGGGAAGAAAATCATCTAAATCATAAGAAAGAAAAAATTCTCATGCTGAT
ACCAGTAAACAAATGGAAGATGAAGGTTAAAAAAGAAGATAATCTAGCAGTTCAGCTAAA
AGAGATGAATCCTCAAAGAAAAGTAGAAGAAACTCTATGAAAGAAGCTAGAACAAAGAAA
GCCAACAATAAATCAGCTTCTAAAGCTTCAAAGAGTGGATCAAAATCCAAAGGTAAAAGT
GCCTCTAAGAGCAAAGGAAAATCATCTTCTAAAGGCAAAAACTCAAAATCTAGAAGTGCC
TCTAAGCCAAAATCAAATGCCGCTTAAAATTCCAACAATACCCATCAAACTGCTGATTCT
AGTGAAAATGCTTCTTCTACTACTCAAACTAGAACTAGAGGAAGACAAAGAGAATAAAAA
GATATGGTTAATGAAAAATCAAATAGCAAATCAAGCTCCAAGGGAAAGAAGAATTCAAAA
TCAAATACAAGATCAAAGTCTAAATCTAAATCTGCTTCTAAATCCAGAAAAAATGCTTCT
AAATCTAAGAAGGATACCACTAATCATGGAAGATAAACTAGATCTAAATCAAGATCTGAG
TCTAAGAGTAAATCTGAAGCTCCTAACAAGAATAGCAATAAGATGGAAGTAATTGAATAA
CCTAAAGAAGAATCCAGTGACAGAAAGAGAAGAGAATCAAGAAGTCAATCTGCTAAAAAA
ACCTCTGATAAGAAATCTAAAAATAGAAGTGACTCTAAGAAGATGACTGCCGAAGATCCT
AAGAAGAACAACGCAGAAGATTCTAAGGGTAAGAAAAAATCCAAAGAAGGAAAGACTGGA
GCTTATGGCAAGAAGGCAAATAAAAAATAATGA