Identifiers and Description

Gene Model Identifier

TTHERM_00989470

Standard Name

MITS13 (MED31-interacting Tetrahymena specific protein 13)

Aliases

PreTt07837 | 185.m00058

Description

Possibly Tetrahymena specific subunit of transcriptional regulator Mediator complex. Co-purified with Med31 in AP-MS experiments.

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( TIGR01031 ) ribosomal protein L32
  • ( TIGR01643 ) YD repeat (two copies)
  • ( PF03310 ) caulimovirus DNA-binding protein
  • ( TIGR00864 ) polycystin cation channel protein
  • ( TIGR00156 ) conserved hypothetical protein TIGR00156

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.4%

TetraMine Data

TTHERM_00989470

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_02922.29.999763672313033e-177hypothetical protein (1870 aa)

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:31280994: Garg J, Saettone A, Nabeel-Shah S, Cadorin M, Ponce M, Marquez S, Pu S, Greenblatt J, Lambert JP, Pearlman RE, Fillingham J (2019) The Med31 Conserved Component of the Divergent Mediator Complex in Tetrahymena thermophila Participates in Developmental Regulation. Current biology : CB 29(14):2371-2379.e6

Sequences

>TTHERM_00989470(coding)
ATGTTCAAAAATTCTCCTAAAGTTTTAGAAAATATCACGAAGGAGTTTAATCAAAAATAA
GAAAACATCTGGAATGAGGAATTTCTTTATATTTGCATAAAAAATTATGATATAAAGTTT
TACAAGGAATAAGCCACTGAACAGCATAAGGAAGAAAGAGCCCTTTATAAATCCGTCATG
TTTTAGTAGCTACAAAATGAATCGAAAGATTTTATTCATAAATTATTTAGTACTTTTATT
ACTGACGAATTGAAGCACATTTATCATGAAAAATTTATGGAGATAAGGAATTCCTTAAAT
CCAAAGGAATAAGAATTCTTTAAATAGAAGTTTCTAAGCAAGATGCAAGAACAGAGAAAC
ACTTTGCTCTAAAATTAGAAAGAAATAGCAGCGTTTATCAATTAGCCAGAAGAAATAAAT
AAATTCACCAAACTACTCAAATAAGAAATCTAAGAATAGCTAAAAAAAGGAGCTTTTCTT
GTTCCTTAATCCCTAAGCAGGTAACCAGTACAAAATGGCTAAAGCGGGAATGTTTCTTCA
GCTTTACCTCATCCTCCAATGCCTCATTAAAATCAATATTAACCTTCAAATACTTCTTCA
TAATAAGGAAATTATAATTAGCAAAATAACTAACAGTAAGCAGCTAGTAGTATCAATCAA
AGTAGTAAATATCCGCCAATTAATATGAATGGAAATAGTGGAAATAATACAAATGTTAAC
AACACTAGCATTTAGAATTAGTAATATCAGTCTAACAATGCAGCTGCTAAAAATTTCGCA
AATCAAAATTAAAATAATTTAAGTAAAGAAAATTAGCAATATACTGGCAGTAATGGTTAA
ATTAACCCAAGTGGAATTCATACCAACTCAAACACTAATAATGATAGTAATAACAATATG
AATGGAAATAGCAATAATATGAATGGGAGCAACAACAGTTTGCCAGGGTAGTCTAATACT
CCCAAAGAAGGCAAAGCAAATAAATTTTAACAGTTACCAATTCCTGCTGGATTCAACACG
AAAAATATCAAATCAAATATTATAGACCCAAATCCTAAAATATTGCAAAATCTTGGAATC
AAAAGCAACAATGATACTAGCAGATAGCCTGTATATAACTAGCCAAACCCTAAAAATTAA
AATGATTTATAGAACAGAAACGAGAGAAGCAACTCTACTTCTTCTCATGGAGGGACTAGC
ATGCAAAATCATTAAATGGAAATTGAAAATTAAGAAATTCCTCCACAAATGAATGTGGAT
GTTTAGAAATAAAAAGACGATGCAAATAATTAATTAAACTCCAATAGAAGTAATAATACT
TCTATCAATGCCCCACAAAAGAATGCAGCAGCTCCTGTAAATATGTTTCCGTTGGATCAA
AAAAAATTGATAAGCCGTAAACTAAAAGTGAAAGCAACTCCTCCTCCAGTAAGTCTAAAC
GATTACATAACATTTTTAAATATGCCTCATATCCCAGAATTTTAGGAAATTGAAAGCAGA
ATCTATGGACTAGACATTGAAGATAAGTTCACAGACCCTCCTTAAATCCCTTTTATTCCA
GAAAGTACAAATAAGAGTCCATTTTAGCAAGATTCAAACTAAGCTTAAGGAAATGGTAAT
TAAAACTAAAATACTATTCCTAAAAATGCAGTTAATAACTCCAACAACTAAAAATAAAAC
TAAGAAAGGAAAAATTTCACTTTATAAAATAGCTCACCTGCAAAAAATATGATGAGAGTA
GGTTCAAACAGTTCAAATTCATCAAGAAATCCAAGCAATAGTAACAACAATAGCAGTAAT
TAGCAGAAAGCAACTCCTCCAAATACTAATCAAATTAGTAATAATACTTAGATTAATAAG
GGAAATACCAGCTTGCCACCAAATAAAAATCCAGTTGGTGGATTTGAGAGCTAGTAAGTA
AAACAGAATATTTAGTAGTAAGTCAGTAATAATCCAAACTAATAACGAATGAGCTTTGAC
TAAAATTAACAAAAAATAAACCCAAACAGCATTTAGCTTTAAAATAATAATAATAATTAG
AGTGTCTAATAATCACCTAAAATTCCTGATTAATTTTAAAATAACTAAGCGAATAAATAG
TAAAATAATAATTTAAATGGGAGATCAATTTAAAATTCTTAAAACTAAATTATCCATTAA
AATCCATAATACCCACCTTAACGAAATAATTATTAGCAAAATACACCAGGTAATTAATAA
AGATAATAACAATAATAGAGTCCTTACCCTTAAAATCCATAAAACAACTAAAATAGTATG
AACAAAGTAAATAACCCAAGTTTAAACCCTGCTAACTAGAACATCAACGTGAATAAAGGA
GTTAATGATATTTAAAAATAAGTAAATCCTAATTAATACAATTAATATTCTTAAAAGAGT
AATATCAATCCCATCAACCAAGACAATCAGTAATATATAAATGGAAATAATAATCCTTAA
TTAAATATTACTCCTTAAAATAATATACCTAACACATAGAGACCACCAAATAATAATCCG
GTTCAAAATTAAAATCAATCTAATTAATCTAACAAAAACTATTAAGGTAATAGTAATAGT
AACCTGAACTAATAAGGTAACAATTATAACTAGAATCCTCCTAATAAATATTAAAATAGC
TAAACTCCAAATTCTAAAACGCCATAACAAGGATATAATCAATAAACAAATTCTACATTT
TAATAAAATTCTAACTAAAACCCTAAACCAAACAGCTAGCAAAACAGTATTAACTATCCA
TAAAATCAAAGAAGTAACAATAATGTAGTAAGTAACAAAGGTTATTAGAATTAACCAGGG
TATAGCTCTAATAATAGTGCAAACCCCAACAATTTTAATAATAATTCTAATTAAATGCAG
CAGAATTACTAGCAATATCCATAGTAAAATGCTGCAAGATCAACAAATCCAGAATAAATA
AATAATTTGAACAATTCTAAAAACAGTACAAATTCAAATTAAGCTCAAAGGAGCATATTA
CCATAAAACGCAATTAGAGGAACATCAGGAGATTTAATTAATTAAAATTTGAGATAAAAT
TCTTCAGGCAGCAATCCAGTAAATTCTAATATAAATCCACAAACTTCATAGTAGATGATT
TATAACACTGGAGGTAGTAACCATTATGTTGACCAAAACAAACCTCGAAATTTAAGCAGT
GGTTCTTAAGGCTAGTTTAGAAAAGAAAATTTAACCTTGAATCCAGATTTAGGTGTGAGC
AATTATATAGAACAAGGAAATAATTATTAAAGTGGTAGCTAGTATAATATTAATTCTGGA
TAAGCTAAAAGAGATAGCAACAATTCTTCATACCACAATTAAAATATATGTGACTAAAGT
ACTCAAAACTCTTTTAACAATTAGGTTTTAATGCATTAAAGTAATGGAAGTAATAGTAAT
AGAAATGCTTAGAATTAAAGCTTCAATTAAAGATCAAGTATCAATAGCAATTATGGATCA
ACTTATGGTAATAATTTTGGTGAATACAACTAACATTCGGGCTTAAATAATGATAAGACA
GGTTCTATTTACGATGAAAATAGCTATTAAAATTAGAGCATGTAAGGTTTAGACAATAAT
AGCTATCAATAAAACGACTATAGCAGCAATCACAACAATAATAACAATGGTTTTTACTTA
GAGAATGACTATAATTAATAATATAAGCAAAATGAATATATCAATGAAGACAATTTAGGA
GGTGGAAACTATTATAATCAAAATAACTTAGATAACTAAAATGTAATCAACAAAAATGCT
AATACTTATGACTATCAATAAAATAATACAAATAATGGCTATTAAGACAATAATACATAC
GATTATAATTATCCTAACTAAAGTAATTATTTGTAAGAATAAGATAATTTAGAAAATACT
TCAGTGAAGAGTTCTTACTACTAAAATAATTAAATTTAGAGTGATATCTATAATGGATAT
GGAGATAATTCCGGTTTTTAAAATTAATAAAATGATTTGAACACTTCTTCTTACAATTAA
TAAAACTCAGTAATAGGTATGGCAGCTCCTACATCGAATCAGTCAAGCATAACATAGAAT
TAGGGAGGATTATCAGATTATAAGAACATGAATTATCAAAACAATTATAATAGCGAAAAT
TTCGCTCCACCTGTTAGTTAGTTTGACTATTAAAATCCTGTCTCTGCAGTAAGTAACATA
GAAGAATAAAAGAGCGTTCAAGATTATAATTCATATTAAGAATAACCATAAGACTAGTCT
TAGGGAAATAATTAGTGGTAGTTTGATACTTATGAAATAAATCCATAATAATAGAATGAT
GTACCTCCTATTAGTGTTCCAAATAATAACATAGAATAATAAAAAGCAGCAGATTTTAAT
TAAGTTAGCTCTCACAATATGCATGGATCAAATTCTTCATTTAGCAATCATGTTTATTAG
TAAGATTCTAATTAACCAGCTAATTAAATTAAAAAAAACTCTACTTAAAATTTTAACAAT
TAAAATATGGGAAATTCTGGAAATTACTCTCTAAATAATTCAATAAGATCAAATTCTTAT
GGAGAAAATTAAACAAGTCAAACATTCATTTAGAATAATTAATAAATTCCATAATATAAT
CAGCAGCCCTATCCAAACCCTACAAACTAATATGAATATGGATTTAACTAGTAAGTAAAT
ATGCCTCAAGCTTAAATTGATGGAGTTAATTAGCCAAATTATAACTAAAGAAGTGGTTCG
TATGATAATAGATAAGTTCTTAACTACTCTCAAGGTTAACAATAAAAATAAAATGTAGGA
ATGGCTTATAACCAGCCTATCTAGCAATTAAATTAAGTCTAAACAAATTAGTAACATTAG
AATTACATTGAAAATAGGAAAACTAGTGCTTAATAAAATATCTAAAGTAGCTCTTAAATA
AATAGCAGCCATAACATGAATGAATAAGTTTATAGTAATAATAATTTATAAATGAATCGT
TCAAATGGTATGCAAAACAACAACAATAACAGTTAAATTAACTATTAAAATGTTAATGCT
AATCAAAATATTCCTATGCAAGCAAATTAAAATAACTACTCAAATTACACACCTGAGTCA
ACTACATCATTACAATCGCCATATCCACAAAATCCAAATAGGCCAGTTAATGAATAAATG
AAATTTTATGGATATACTAATGATTAAAGGAGCTACAATTCAAGTACACCTTCTACGACT
TACGAAGGCTAAAATGATATTAACTAGGCTGCAAGATTTAATTAGAATTTAAATTATCAG
AACTAGTAACCAATTTAGCAACCAAAACCATAAGCAATTATTCCTTAAGCTTAATTCAAT
CCTCATCCATTAAATACTAGTGCAGGACCAGCTGTTGATAAAGTCTAAGTTTATAAGACA
ACTTAAGACTTTGAAGGTGACAGCCCTGATTTCAAAATCATAAACTCAGCCTTCGAAAAG
GGAAATTACTCCAATCCGTACCAAGAATAAATTAAAAAAGATATAAAACAATTTAAGCAA
GTAAAACAAAATATTATTTTAGAAATCTAGCACAACATTTAGGATCCTAAAAGCTTTTAC
ATACTAATAAATGATGAAAAAAGAAAGAATTATGGGTGCTTGAAAATCTTAGTCACTCCA
TAGTAATATAAAATGATTGAATTCCTACATATCGAAAAAGCAGGTTAAATCCTCAAATCA
GTAAATAGTAACACAAAATTAATCGATTTGATTAAGCACTGGTGGAAATTTGAATATGAC
ATGCAAAATAAAAAATGA


>TTHERM_00989470(protein)
MFKNSPKVLENITKEFNQKQENIWNEEFLYICIKNYDIKFYKEQATEQHKEERALYKSVM
FQQLQNESKDFIHKLFSTFITDELKHIYHEKFMEIRNSLNPKEQEFFKQKFLSKMQEQRN
TLLQNQKEIAAFINQPEEINKFTKLLKQEIQEQLKKGAFLVPQSLSRQPVQNGQSGNVSS
ALPHPPMPHQNQYQPSNTSSQQGNYNQQNNQQQAASSINQSSKYPPINMNGNSGNNTNVN
NTSIQNQQYQSNNAAAKNFANQNQNNLSKENQQYTGSNGQINPSGIHTNSNTNNDSNNNM
NGNSNNMNGSNNSLPGQSNTPKEGKANKFQQLPIPAGFNTKNIKSNIIDPNPKILQNLGI
KSNNDTSRQPVYNQPNPKNQNDLQNRNERSNSTSSHGGTSMQNHQMEIENQEIPPQMNVD
VQKQKDDANNQLNSNRSNNTSINAPQKNAAAPVNMFPLDQKKLISRKLKVKATPPPVSLN
DYITFLNMPHIPEFQEIESRIYGLDIEDKFTDPPQIPFIPESTNKSPFQQDSNQAQGNGN
QNQNTIPKNAVNNSNNQKQNQERKNFTLQNSSPAKNMMRVGSNSSNSSRNPSNSNNNSSN
QQKATPPNTNQISNNTQINKGNTSLPPNKNPVGGFESQQVKQNIQQQVSNNPNQQRMSFD
QNQQKINPNSIQLQNNNNNQSVQQSPKIPDQFQNNQANKQQNNNLNGRSIQNSQNQIIHQ
NPQYPPQRNNYQQNTPGNQQRQQQQQSPYPQNPQNNQNSMNKVNNPSLNPANQNINVNKG
VNDIQKQVNPNQYNQYSQKSNINPINQDNQQYINGNNNPQLNITPQNNIPNTQRPPNNNP
VQNQNQSNQSNKNYQGNSNSNLNQQGNNYNQNPPNKYQNSQTPNSKTPQQGYNQQTNSTF
QQNSNQNPKPNSQQNSINYPQNQRSNNNVVSNKGYQNQPGYSSNNSANPNNFNNNSNQMQ
QNYQQYPQQNAARSTNPEQINNLNNSKNSTNSNQAQRSILPQNAIRGTSGDLINQNLRQN
SSGSNPVNSNINPQTSQQMIYNTGGSNHYVDQNKPRNLSSGSQGQFRKENLTLNPDLGVS
NYIEQGNNYQSGSQYNINSGQAKRDSNNSSYHNQNICDQSTQNSFNNQVLMHQSNGSNSN
RNAQNQSFNQRSSINSNYGSTYGNNFGEYNQHSGLNNDKTGSIYDENSYQNQSMQGLDNN
SYQQNDYSSNHNNNNNGFYLENDYNQQYKQNEYINEDNLGGGNYYNQNNLDNQNVINKNA
NTYDYQQNNTNNGYQDNNTYDYNYPNQSNYLQEQDNLENTSVKSSYYQNNQIQSDIYNGY
GDNSGFQNQQNDLNTSSYNQQNSVIGMAAPTSNQSSITQNQGGLSDYKNMNYQNNYNSEN
FAPPVSQFDYQNPVSAVSNIEEQKSVQDYNSYQEQPQDQSQGNNQWQFDTYEINPQQQND
VPPISVPNNNIEQQKAADFNQVSSHNMHGSNSSFSNHVYQQDSNQPANQIKKNSTQNFNN
QNMGNSGNYSLNNSIRSNSYGENQTSQTFIQNNQQIPQYNQQPYPNPTNQYEYGFNQQVN
MPQAQIDGVNQPNYNQRSGSYDNRQVLNYSQGQQQKQNVGMAYNQPIQQLNQVQTNQQHQ
NYIENRKTSAQQNIQSSSQINSSHNMNEQVYSNNNLQMNRSNGMQNNNNNSQINYQNVNA
NQNIPMQANQNNYSNYTPESTTSLQSPYPQNPNRPVNEQMKFYGYTNDQRSYNSSTPSTT
YEGQNDINQAARFNQNLNYQNQQPIQQPKPQAIIPQAQFNPHPLNTSAGPAVDKVQVYKT
TQDFEGDSPDFKIINSAFEKGNYSNPYQEQIKKDIKQFKQVKQNIILEIQHNIQDPKSFY
ILINDEKRKNYGCLKILVTPQQYKMIEFLHIEKAGQILKSVNSNTKLIDLIKHWWKFEYD
MQNKK


>TTHERM_00989470(gene)
ATGTTCAAAAATTCTCCTAAAGTTTTAGAAAATATCACGAAGGAGTTTAATCAAAAATAA
GAAAACATCTGGAATGAGGAATTTCTTTATATTTGCATAAAAAATTATGATATAAAGTTT
TACAAGGAATAAGCCACTGAACAGCATAAGGAAGAAAGAGCCCTTTATAAATCCGTCATG
TTTTAGTAGCTACAAAATGAATCGAAAGATTTTATTCATAAATTATTTAGTACTTTTATT
ACTGACGAATTGAAGCACATTTATCATGAAAAATTTATGGAGATAAGGAATTCCTTAAAT
CCAAAGGAATAAGAATTCTTTAAATAGAAGTTTCTAAGCAAGATGCAAGAACAGAGAAAC
ACTTTGCTCTAAAATTAGAAAGAAATAGCAGCGTTTATCAATTAGCCAGAAGAAATAAAT
AAATTCACCAAACTACTCAAATAAGAAATCTAAGAATAGCTAAAAAAAGGAGCTTTTCTT
GTTCCTTAATCCCTAAGCAGGTAACCAGTACAAAATGGCTAAAGCGGGAATGTTTCTTCA
GCTTTACCTCATCCTCCAATGCCTCATTAAAATCAATATTAACCTTCAAATACTTCTTCA
TAATAAGGAAATTATAATTAGCAAAATAACTAACAGTAAGCAGCTAGTAGTATCAATCAA
AGTAGTAAATATCCGCCAATTAATATGAATGGAAATAGTGGAAATAATACAAATGTTAAC
AACACTAGCATTTAGAATTAGTAATATCAGTCTAACAATGCAGCTGCTAAAAATTTCGCA
AATCAAAATTAAAATAATTTAAGTAAAGAAAATTAGCAATATACTGGCAGTAATGGTTAA
ATTAACCCAAGTGGAATTCATACCAACTCAAACACTAATAATGATAGTAATAACAATATG
AATGGAAATAGCAATAATATGAATGGGAGCAACAACAGTTTGCCAGGGTAGTCTAATACT
CCCAAAGAAGGCAAAGCAAATAAATTTTAACAGTTACCAATTCCTGCTGGATTCAACACG
AAAAATATCAAATCAAATATTATAGACCCAAATCCTAAAATATTGCAAAATCTTGGAATC
AAAAGCAACAATGATACTAGCAGATAGCCTGTATATAACTAGCCAAACCCTAAAAATTAA
AATGATTTATAGAACAGAAACGAGAGAAGCAACTCTACTTCTTCTCATGGAGGGACTAGC
ATGCAAAATCATTAAATGGAAATTGAAAATTAAGAAATTCCTCCACAAATGAATGTGGAT
GTTTAGAAATAAAAAGACGATGCAAATAATTAATTAAACTCCAATAGAAGTAATAATACT
TCTATCAATGCCCCACAAAAGAATGCAGCAGCTCCTGTAAATATGTTTCCGTTGGATCAA
AAAAAATTGATAAGCCGTAAACTAAAAGTGAAAGCAACTCCTCCTCCAGTAAGTCTAAAC
GATTACATAACATTTTTAAATATGCCTCATATCCCAGAATTTTAGGAAATTGAAAGCAGA
ATCTATGGACTAGACATTGAAGATAAGTTCACAGACCCTCCTTAAATCCCTTTTATTCCA
GAAAGTACAAATAAGAGTCCATTTTAGCAAGATTCAAACTAAGCTTAAGGAAATGGTAAT
TAAAACTAAAATACTATTCCTAAAAATGCAGTTAATAACTCCAACAACTAAAAATAAAAC
TAAGAAAGGAAAAATTTCACTTTATAAAATAGCTCACCTGCAAAAAATATGATGAGAGTA
GGTTCAAACAGTTCAAATTCATCAAGAAATCCAAGCAATAGTAACAACAATAGCAGTAAT
TAGCAGAAAGCAACTCCTCCAAATACTAATCAAATTAGTAATAATACTTAGATTAATAAG
GGAAATACCAGCTTGCCACCAAATAAAAATCCAGTTGGTGGATTTGAGAGCTAGTAAGTA
AAACAGAATATTTAGTAGTAAGTCAGTAATAATCCAAACTAATAACGAATGAGCTTTGAC
TAAAATTAACAAAAAATAAACCCAAACAGCATTTAGCTTTAAAATAATAATAATAATTAG
AGTGTCTAATAATCACCTAAAATTCCTGATTAATTTTAAAATAACTAAGCGAATAAATAG
TAAAATAATAATTTAAATGGGAGATCAATTTAAAATTCTTAAAACTAAATTATCCATTAA
AATCCATAATACCCACCTTAACGAAATAATTATTAGCAAAATACACCAGGTAATTAATAA
AGATAATAACAATAATAGAGTCCTTACCCTTAAAATCCATAAAACAACTAAAATAGTATG
AACAAAGTAAATAACCCAAGTTTAAACCCTGCTAACTAGAACATCAACGTGAATAAAGGA
GTTAATGATATTTAAAAATAAGTAAATCCTAATTAATACAATTAATATTCTTAAAAGAGT
AATATCAATCCCATCAACCAAGACAATCAGTAATATATAAATGGAAATAATAATCCTTAA
TTAAATATTACTCCTTAAAATAATATACCTAACACATAGAGACCACCAAATAATAATCCG
GTTCAAAATTAAAATCAATCTAATTAATCTAACAAAAACTATTAAGGTAATAGTAATAGT
AACCTGAACTAATAAGGTAACAATTATAACTAGAATCCTCCTAATAAATATTAAAATAGC
TAAACTCCAAATTCTAAAACGCCATAACAAGGATATAATCAATAAACAAATTCTACATTT
TAATAAAATTCTAACTAAAACCCTAAACCAAACAGCTAGCAAAACAGTATTAACTATCCA
TAAAATCAAAGAAGTAACAATAATGTAGTAAGTAACAAAGGTTATTAGAATTAACCAGGG
TATAGCTCTAATAATAGTGCAAACCCCAACAATTTTAATAATAATTCTAATTAAATGCAG
CAGAATTACTAGCAATATCCATAGTAAAATGCTGCAAGATCAACAAATCCAGAATAAATA
AATAATTTGAACAATTCTAAAAACAGTACAAATTCAAATTAAGCTCAAAGGAGCATATTA
CCATAAAACGCAATTAGAGGAACATCAGGAGATTTAATTAATTAAAATTTGAGATAAAAT
TCTTCAGGCAGCAATCCAGTAAATTCTAATATAAATCCACAAACTTCATAGTAGATGATT
TATAACACTGGAGGTAGTAACCATTATGTTGACCAAAACAAACCTCGAAATTTAAGCAGT
GGTTCTTAAGGCTAGTTTAGAAAAGAAAATTTAACCTTGAATCCAGATTTAGGTGTGAGC
AATTATATAGAACAAGGAAATAATTATTAAAGTGGTAGCTAGTATAATATTAATTCTGGA
TAAGCTAAAAGAGATAGCAACAATTCTTCATACCACAATTAAAATATATGTGACTAAAGT
ACTCAAAACTCTTTTAACAATTAGGTTTTAATGCATTAAAGTAATGGAAGTAATAGTAAT
AGAAATGCTTAGAATTAAAGCTTCAATTAAAGATCAAGTATCAATAGCAATTATGGATCA
ACTTATGGTAATAATTTTGGTGAATACAACTAACATTCGGGCTTAAATAATGATAAGACA
GGTTCTATTTACGATGAAAATAGCTATTAAAATTAGAGCATGTAAGGTTTAGACAATAAT
AGCTATCAATAAAACGACTATAGCAGCAATCACAACAATAATAACAATGGTTTTTACTTA
GAGAATGACTATAATTAATAATATAAGCAAAATGAATATATCAATGAAGACAATTTAGGA
GGTGGAAACTATTATAATCAAAATAACTTAGATAACTAAAATGTAATCAACAAAAATGCT
AATACTTATGACTATCAATAAAATAATACAAATAATGGCTATTAAGACAATAATACATAC
GATTATAATTATCCTAACTAAAGTAATTATTTGTAAGAATAAGATAATTTAGAAAATACT
TCAGTGAAGAGTTCTTACTACTAAAATAATTAAATTTAGAGTGATATCTATAATGGATAT
GGAGATAATTCCGGTTTTTAAAATTAATAAAATGATTTGAACACTTCTTCTTACAATTAA
TAAAACTCAGTAATAGGTATGGCAGCTCCTACATCGAATCAGTCAAGCATAACATAGAAT
TAGGGAGGATTATCAGATTATAAGAACATGAATTATCAAAACAATTATAATAGCGAAAAT
TTCGCTCCACCTGTTAGTTAGTTTGACTATTAAAATCCTGTCTCTGCAGTAAGTAACATA
GAAGAATAAAAGAGCGTTCAAGATTATAATTCATATTAAGAATAACCATAAGACTAGTCT
TAGGGAAATAATTAGTGGTAGTTTGATACTTATGAAATAAATCCATAATAATAGAATGAT
GTACCTCCTATTAGTGTTCCAAATAATAACATAGAATAATAAAAAGCAGCAGATTTTAAT
TAAGTTAGCTCTCACAATATGCATGGATCAAATTCTTCATTTAGCAATCATGTTTATTAG
TAAGATTCTAATTAACCAGCTAATTAAATTAAAAAAAACTCTACTTAAAATTTTAACAAT
TAAAATATGGGAAATTCTGGAAATTACTCTCTAAATAATTCAATAAGATCAAATTCTTAT
GGAGAAAATTAAACAAGTCAAACATTCATTTAGAATAATTAATAAATTCCATAATATAAT
CAGCAGCCCTATCCAAACCCTACAAACTAATATGAATATGGATTTAACTAGTAAGTAAAT
ATGCCTCAAGCTTAAATTGATGGAGTTAATTAGCCAAATTATAACTAAAGAAGTGGTTCG
TATGATAATAGATAAGTTCTTAACTACTCTCAAGGTTAACAATAAAGTAAATATTTTATT
TATTTTTTATTTTTTTAAATATTTTAAAATAAAATTTGTCTAAATTTAATTAAAATAAAA
AAATTAAGCAAAAACTAAATTAATAAATAAATAATAAAGTAAAATTATCTCGTAAAATAT
GATTTAAAATTGAAAAACAAAAAAAATCTATTTTAAAATAGAATAAATTAAATTAGTTAA
TGATAAAAAATTGATCAAAAAAATAAATAAATAACAAACTTTATTTAATAAAATAGAATA
AAATGTAGGAATGGCTTATAACCAGCCTATCTAGCAATTAAATTAAGTCTAAACAAATTA
GTAACATTAGAATTACATTGAAAATAGGAAAACTAGTGCTTAATAAAATATCTAAAGTAG
CTCTTAAATAAATAGCAGCCATAACATGAATGAATAAGTTTATAGTAATAATAATTTATA
AATGAATCGTTCAAATGGTATGCAAAACAACAACAATAACAGTTAAATTAACTATTAAAA
TGTTAATGCTAATCAAAATATTCCTATGCAAGCAAATTAAAATAACTACTCAAATTACAC
ACCTGAGTCAACTACATCATTACAATCGCCATATCCACAAAATCCAAATAGGCCAGTTAA
TGAATAAATGAAATTTTATGGATGTAATAAAAAATTTTATTTTTTTTATACAATTTTATA
AGAATTTTAGATATTTTTATTAATGAGAATTTTTTAATTAAAATATTTTTTAATATCTCT
TCATAGATACTAATGATTAAAGGAGCTACAATTCAAGTACACCTTCTACGACTTACGAAG
GCTAAAATGATATTAACTAGGCTGCAAGATTTAATTAGAATTTAAATTATCAGAACTAGT
AACCAATTTAGCAACCAAAACCATAAGCAATTATTCCTTAAGCTTAATTCAATCCTCATC
CATTAAATACTAGTGCAGGACCAGCTGTTGATAAAGTCTAAGTTTATAAGACAACTTAAG
ACTTTGAAGGTGACAGCCCTGATTTCAAAATCATAAACTCAGCCTTCGAAAAGGGAAATT
ACTCCAATCCGTACCAAGAATAAATTAAAAAAGATATAAAACAATTTAAGCAAGTAAAAC
AAAATATTATTTTAGAAATCTAGCACAACATTTAGGATCCTAAAAGCTTTTACATACTAA
TAAATGATGAAAAAAGAAAGAATTATGGGTGCTTGAAAATCTTAGTCACTCCATAGTAAT
ATAAAATGATTGAATTCCTACATATCGAAAAAGCAGGTTAAATCCTCAAATCAGTAAATA
GTAACACAAAATTAATCGATTTGATTAAGCACTGGTGGAAATTTGAATATGACATGCAAA
ATAAAAAATGA