Identifiers and Description

Gene Model Identifier

TTHERM_00829330

Standard Name

MITS10 (MED31-interacting Tetrahymena specific protein 10)

Aliases

PreTt14111 | 144.m00074

Description

Possibly Tetrahymena specific subunit of transcriptional regulator Mediator complex. Co-purified with Med31 in AP-MS experiments.

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF00904 ) Involucrin repeat
  • ( TIGR00864 ) polycystin cation channel protein
  • ( TIGR00161 ) conserved hypothetical protein TIGR00161
  • ( TIGR01442 ) small, acid-soluble spore protein, gamma-type

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 11.4%

TetraMine Data

TTHERM_00829330

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

No Data fetched for Homologs

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:31280994: Garg J, Saettone A, Nabeel-Shah S, Cadorin M, Ponce M, Marquez S, Pu S, Greenblatt J, Lambert JP, Pearlman RE, Fillingham J (2019) The Med31 Conserved Component of the Divergent Mediator Complex in Tetrahymena thermophila Participates in Developmental Regulation. Current biology : CB 29(14):2371-2379.e6

Sequences

>TTHERM_00829330(coding)
ATGCTTTCCAAAAGAATACTCCAATCTCTTACCTAATCGTAATCATGTCCATCATCAAAG
TAGCTAGTTTGCTCAGAAAATATGAAAATTAATATAATAACATGGATTTATGAGGGTTAT
CTTAACGAATTTAACAAGCCTCGAGATCAATTATAAGATATTAATTAGAGGGCAATTGAA
AAGAAAGAATTTGAAAATTATCTTGAGTAAAAATTAAGCGATATCAGCATTAATTATGTT
GAGATATTTCAAAAAAATTTAATGAGCTGGCTTTATTCTTTCTTAACTAGAATAAATACT
TAAGCTAGCGAGTTAATTAAGAACAAAAACAATTAAGTGTAGCTCTTTGATTCAGTTAAG
AAAAGCAATCCACAAGCTTAGGAAATTATAGACTGTTTTATCTAAGCAAAGCCTGATCCA
TAAATCAAGGAATCAATCAGTAAGTTTATCACTTTAATTAGCCAACAGCAAGCACCAAAT
TAAGAAAACTAGAATTAACACTAATAAGCTAATAATCACCCATAGTATAATAACTACAAT
TAAGCAGGTAGAATGCAGTAAGGAGGTTTATCACAAAATACGCAATAAAATCCTTAGTAA
AGTAATCAACAAGTTAAATAAATTCCTCCATAGGGCTAGTAGCAGAATTAGTAAGACTAC
TAAGAAGGCTAGCCCTTGTTAAATAATGTACCAAATAAATAGTAATATTTAGATTAACAA
TAGTATTCAGCGCAAAAATAGTAGTAACAACCTTATAATACTAAAAATAACTCTATTTAA
CCTATCAATTAGCATCAAAATGGTTAACAGTAGCCATCTTAATAGCTTAATCCTTAGTAA
GCACATAATATGCAAATGTAGTAAAATATGCCTTAAAATGGACAAAAATACTCTATGAAC
GGTTAAATGAATCCCAATAGCAGCAATTTAGCACCTTCTAGTTCTTCAGCTGCTAATCCT
GGATAAACTTATAATCCATAAAACAAACAAATGAGTTCTGCTTAGCAACAACAATTATTA
TAATAGCAAAAGCAATACTAATAGAATACTCACGAATACACTGCCTCTAATAAGAATCCA
TAAAATCTGGCAAACTAAGGTTAAAGCAACCACTAAAATAATTAGTAAATACCTTCAAAC
TAGCACCATCCATCACAATATAGCTAGGGTCATATAAATGGGCCTAATTAAAACTAGCAG
CAATACTCTGCAAACTAAAGTCCAAGTTTGGCTAATAGAGCAGCAACTTAAGGATAGCCT
TAAACATAGAGCGACTAATCCAAATAAATGTCTTCTTATGCCTATCAATAGCAATAGTAG
TAAATTAACCAAGGATAACATAGCTAGAACCTTGGTAGATAAAACGGTTAGCCTCCATAA
ATTCCTAATCAATAATAGCAAAACTACTAAACTCAATCAAATTAATAGTAAAATCCATTA
TAGAAATAGCAACAACAATAACAACCACCTGCACATTTATAATAATAATAAGCTAAAAAT
ATTAATTAAAATAATTAACAGCAATTGCAGAGTTAGCAATCCCAATCATAATAAATGCAG
TAATAATAATAACAATAGCAATAGGGGTAATAGTAAGTCCTTTTGTAGTAATAAAAGTAA
GGTGGCTAACCAAATTAGATTCCTCCTTCAAATATGCAATAAAGAGCTCATTGGAATAAT
TAAAATAAAGCAGGTAACCCTCAATAAAATAATTTTTAAGTTAATCATTAAATGTAAGTC
AATCAAAATTAGAAAATGAATGGAGAAACTAACCCCTAAGTCCCAAAAGAAGAATAAGAT
TTGAACTCATAAAAAAATAATATGAATTCTCAGTAAAATATTTCACAACAAATGCAATAA
TAAAATTAAACTCAAATTCCACCAAATCACATTCAAAACCAAAATATGCAATAAACAGGT
GCTGGAGCTGCTAATATGAACCTTAATAATAGACAAAATATGATGGCAAATAGAGCATAA
AACTAATAAGGAAACCCTCAATAGGTGCAGCAAGGATCTAATTAATAGCAACAACCTCCT
AATCAGTAAGTACCACCAAACAATGTTCCAGGAAATTTCCATTAATAAAATGGGTAAAAT
TAAAACCCATCAAGCATGAACTAGTTATAAATTTAGCAGTAATAAAATGTTTAAAAATAA
AGAGGAAGAAGTAATAACTCAGCTGCAAATTTGAATCAGATGAATGAATAAAACTAATAA
ATTACTTCTAACTCACAACCACCCACAAATAATCCTTAATAAACAGGAATGTAATAGCAA
TTAAAGCCAAATCATTAAATTGCATAAAATATTTAACAATAGTAGCAATAAAATTTAAAA
CCTGGTCAGGTAATTCCAGGACAGCCGCAATAAGGCTAAAAAGGTTTTCCTAATTAACAA
TAATTATAACCTCTACCAAATGCGATATAAAATTAAAATATGCCTCCATCTGGGTATCCT
CATCTCTAATAAAATGGAAATGGACTAACTACAATAAGCTCACAAGGATCTAAAGTGAGA
ATCACTAAATCATAAACACCAGCACCAGATCAGATTTAGTAATAATAATTTTAACCACCT
CAAGTTGATCAATAATTACAGTAATAATAGTAAGAAATTTAATCTTAACCTCCTGCTGCT
GCAACAGCAGCTAATACTACTGCTCCTACTACTAATGTTGCTAACCCCACTAATGCTGCT
ACTACTACAACAAATATTACAACAACAGCAGCAACAACAACAACAACAACAACTGCAAAA
AGAAGAGGATCGTCATAAAATGTATAAAAAGAAGTACCTTTAAGGAAAAAAGCTTCTAAA
AGACAGCCAAGCAATTAAGTAAAAGAAGAATCTGATACAATTTAAACATAATCTTAAATT
TAATAACAGTAAGTACAGAACTAATCCAATCAAAGAGAATAGAATAATATCCCTAACGGA
GTTAGCGGATAGGGAGTGCAGTCAAATAATGCAGCAGGACCAGGGCAGGTAGGATAGACA
TCATCATTATTGGGAGCAGCACAAATTCCAACAACATTGCCAGTACCTTACAACTAATTT
CATTAGCAACAGAATCCTCAAAACTAAATGCCTCAGCCTATAGCGCCCAATCATCCTTAA
GTTTAAAGGAGTGCATATCCACAACAAGGAGAGCTAGCAGCTACCAATCATCCATCTGAA
ATATATTTCAAAGAAAACTATCCTGTTAAACAATAGTAAATACCAGGAGGTTAATAGCAA
ATTCCTTAAGGTACTAATTACCTACAAAATTAACTCACATAACCTGATGCTAATGGTCAC
TAACCACCCTAAAATCCTCGAGTTATAGAGTAAGAGTAAGATAGACCCCCTAAATTTAAC
TAAAATCCTGCTCTTATAAATTAAAGTCCCTCTAAATAACTAACCTCTTTAAATCCCTAA
GGAACTAAAGGGCAGCAGCCTATATAGCCTTAACTGGGTCAGAATGTTTAGTCTTAATTC
CCTCCTCTGAACCAACCGAGCAGCTCCTAGATAGAAACAGGTGCATAGCTTCCCACTAAC
TAATAAATTTAACCGTAGCCTGCTCCAACTCAACCTCCAATAAACAGTCGTCGTAAAAAT
ACGAGCAACTCTATCAAATAAGGAGAACAGCCCACCAAAAAAGTTAAGGCTAATCCATAA
ACGAACCCTTCCCAAAAAAACGACTAGCAAGATTTGTAAAATCCTCCTCCTGCCCCAGTT
TTAGGACCAGCGCAACCCACAGTATAAGGAAATCCCATACCTCCTCAAACTAACAACGTT
TAAACTTCTTTATAAAACTAGCAGCAAATCAAGTAACAAGGTTTAAAGCAACAATAACAA
TTTATCTAAAATTAATTGACAAATTAGCCTCAAATCCCAAGTTCAAATTAGATTCCTTAA
GATCCACAATCCTTTTAACAAAAGTAACAAAATCAAAATATTTAGCTCCAATAAAATGCA
TAATAGTAGCAATTACAATAATAAAAAAACATGACTGCTCAATAAAAAAAGTCACAATAA
AATTAGATATAATAATAACAAAATGTTTAATAATAAATACCAACTCAAGTTAATCCTAAC
TTATAGTAACAATAATTATAATAATAGTCTTAACAGCAACAATAGCTTTAACAATAATTA
CAACAACAGTAAACACAATAGCCAGCAAGTAATTTATTGTAGCATAATTCTCAAATACAA
AATCCCTAGAATCCAAATTTAGTTTAAAATTAGCTCTTTGTTAAATAGCAGCAAACATAA
CTATAATAAACTTAATAAAATAAATAATTTTAACCACAGTCTCTTCATTCTTCAGGTCAT
TCGGTAGGTTAAAAATACAACCCTGCTGCTGAATAGCCATTTTAATAATAATAAAATCTT
GCTTAGTAAGGAAAAGACAGTAATTTGGATAGTTATGGTAATCCTACTCCTTTTAACTCA
TAAATGAATACATAATAGTAACCTTAATAGCAAAGTGGTGTAACACAGCATTAGTAACAA
CCTAATTCTAGATAGCCACCATTATAAATTTAACAGTAGTAATAGCAAATAAATAATAGA
TAGAATCTTCACTAATCTAATAATGAAAGAAATATTCATTCAAGTGCTCATTTAACACCA
TCTAAAAATCATGCAAATAATAGTTAATAGTTCTAACAATAATAAGCATAATAATAACAA
TAACAGCCAAATCCAAATCCAAATATGCAACAGTAAAATTTACAGCATAGTGGATAAAAT
TAATAATAGCAATAAATATTTAACTACTAGCAAAATCCACATAATCCAAAATATCCTTAA
TAATAGCAACCATTACCATTAAATTAATATTAACAGCAATTTAACTCTTAGGGTGGACTA
AATCAATCTGGTAGTAGTTAGGGTGGACACTAGCCTAGTAGCTTAAATTCTTCTGCATAG
CTTTTATCTAGTTAACAATAGCATGTAAGCTAGAATCCTAATAATTAGCAATCCCAATAG
CAATAACATCAATTTAGATTGAGCTAGTCAGGAGGATAAACTAACTAGATTCCATCTCAG
AACCCGTAGCCAAATTCATTACAATAATAGCAATATAATAACATGTAATAATAGTAAAAT
AAACCATTTAATCCATAATAGCAAATAATGAATTAATAGCAGGCTAATTAAAATCCATCT
ATAGGAGCTCAGATTTAAGGTTAAGGAAATCCTTAGAATATTCATCAAAATAAGTAAATG
GTTGGAAGCTAGACAGGGTTGACAGATTCATAGCAATAGTAATAAATGATTGAATAGCAG
CAGCAAGCTTAGTAGAGATAATAGAAGAACAAATATTTATAAGATTAGGCTAAGTAGCAA
TAACAAAATTAAATGGCCTAATAACAATAACAACAACAGTCTATTCCCAATTAAAATTAA
TATGCACAATAATAATCTATGAAAAGTAGTAATAATATTGAGTACTAAAGATAATCTTAA
GGATAGGGGAGTTAGAATCCTCAATAAATTCATTAACAATAACAACAAATGGTATAGTAA
TAACAAGTATAGTAGCAGTAACCTTTATAGCCTGGCAATCCATAATAAGTGTAGCAAGGT
TTCCCGAATTAAGTAAATAATTAACCACCTCAAAATATTTAGTAATCAACACCTCAAAGA
AATGGCTAAATGTAGATAAAGGTTAATCCATAATTAGCATAAGCAGCAACTCAACCATAG
ATTGGCACTTAGGGAAGCTAAATGTAGCAAGGAGGCATATAAAATAACTAGATGCAAAGA
AATACACCGCAATAAGGATAAAAGAATGCTGCTGGACCATAAAATTAAGCAGTAAATGGT
CAAATTATACAATAAGGATAGTAGATTAAGCAAAATAATATTCCAATAAATAACAATCCA
AACCAGATGAATCCCAATCCAAATTAGAAGTAATAGCAAGATCTAAGACACCAATAATAG
TTATAAGAAATAGCATAGCAATAGCAAAACCCTAGCAACAATATTTAATACCAAAAAGCT
TAGTTATAAGGAATGCAATAAAGGTAATAAAATCAGGAAAAAATTAATCCAAATAATCAA
TAGTAATAATATGGGCCTCATTATTAGAAGTAACAACAGCCAAACTAAAATATAAACTAA
GTGCAAAAACCTTAATCTTAGCAGTAGATTCCAATTCATCCAAATTAGATTACTGGATAA
TAGCAAATGGCTAATAACCCTTAAAATAGCAGTGGACTACAATAGCCAAACTAATAAAAA
AATAACCTCTAAAACTCTAATCATCTATCTTCAAGCAATTAATACACTCCTCCGTAACAG
CAGTAATAAGGAATTGGAGGACACACACCATCTTAAATACAAACTTAAAACCTTTAACAA
ATTCAACCTCACAATATTTCAGAAAATAGTAATATTTATTACCAATAATAAAATTCTTCA
TTTTAATAGCAATTGCATGTGCCCTAATAGATGGCACAAGCGCAATAATACTAGAAACAA
TAGTAGCACTAAGCTTAGCAGTTTCAAAATTAACATTCAATTCCCCCAAATTCAATTAAA
CAATAAAATTATAATGAAAATATAGGATACAATAATCCTGAATAACAGAACCTAAGTAGA
AGCTACGAAGATATTTAAAATAGATATAATGTGCAATAACAGCAACAAGCACAAAATATG
CCTTAAAATTTAACTCAGAATAATTATGAATAAGAATAAAATGTATTAAAAGCAAAGGAA
TACATAAGACAAGCCTGTGATTAGAGAGGTTTGGGACAACAAGATGTTACAAATTTATTC
AGAGAGATTGATAACTTAGTTTTAAGAAGAAAAGATGAATTCATTATTGATTTTGAAATA
GAATATAATTAGTGTTTGATTATTGAGGTAAAACTTAAAAAGAATAATGCATTTGGTTCT
CTCCGAGTCGATTTTGACAGACAAACACTTAAATATAAAATTTTTTCCATGAATTATGAT
TATAGCTTCACTGATAAAGAAAGGGAATATGATAAGATCATGGATGTAATTGGAGTATGG
TACAAGTTCTAATAATAGCAGAATAAAGACAGCTAACCTTGA


>TTHERM_00829330(protein)
MLSKRILQSLTQSQSCPSSKQLVCSENMKINIITWIYEGYLNEFNKPRDQLQDINQRAIE
KKEFENYLEQKLSDISINYVEIFQKNLMSWLYSFLTRINTQASELIKNKNNQVQLFDSVK
KSNPQAQEIIDCFIQAKPDPQIKESISKFITLISQQQAPNQENQNQHQQANNHPQYNNYN
QAGRMQQGGLSQNTQQNPQQSNQQVKQIPPQGQQQNQQDYQEGQPLLNNVPNKQQYLDQQ
QYSAQKQQQQPYNTKNNSIQPINQHQNGQQQPSQQLNPQQAHNMQMQQNMPQNGQKYSMN
GQMNPNSSNLAPSSSSAANPGQTYNPQNKQMSSAQQQQLLQQQKQYQQNTHEYTASNKNP
QNLANQGQSNHQNNQQIPSNQHHPSQYSQGHINGPNQNQQQYSANQSPSLANRAATQGQP
QTQSDQSKQMSSYAYQQQQQQINQGQHSQNLGRQNGQPPQIPNQQQQNYQTQSNQQQNPL
QKQQQQQQPPAHLQQQQAKNINQNNQQQLQSQQSQSQQMQQQQQQQQQGQQQVLLQQQKQ
GGQPNQIPPSNMQQRAHWNNQNKAGNPQQNNFQVNHQMQVNQNQKMNGETNPQVPKEEQD
LNSQKNNMNSQQNISQQMQQQNQTQIPPNHIQNQNMQQTGAGAANMNLNNRQNMMANRAQ
NQQGNPQQVQQGSNQQQQPPNQQVPPNNVPGNFHQQNGQNQNPSSMNQLQIQQQQNVQKQ
RGRSNNSAANLNQMNEQNQQITSNSQPPTNNPQQTGMQQQLKPNHQIAQNIQQQQQQNLK
PGQVIPGQPQQGQKGFPNQQQLQPLPNAIQNQNMPPSGYPHLQQNGNGLTTISSQGSKVR
ITKSQTPAPDQIQQQQFQPPQVDQQLQQQQQEIQSQPPAAATAANTTAPTTNVANPTNAA
TTTTNITTTAATTTTTTTAKRRGSSQNVQKEVPLRKKASKRQPSNQVKEESDTIQTQSQI
QQQQVQNQSNQREQNNIPNGVSGQGVQSNNAAGPGQVGQTSSLLGAAQIPTTLPVPYNQF
HQQQNPQNQMPQPIAPNHPQVQRSAYPQQGELAATNHPSEIYFKENYPVKQQQIPGGQQQ
IPQGTNYLQNQLTQPDANGHQPPQNPRVIEQEQDRPPKFNQNPALINQSPSKQLTSLNPQ
GTKGQQPIQPQLGQNVQSQFPPLNQPSSSQIETGAQLPTNQQIQPQPAPTQPPINSRRKN
TSNSIKQGEQPTKKVKANPQTNPSQKNDQQDLQNPPPAPVLGPAQPTVQGNPIPPQTNNV
QTSLQNQQQIKQQGLKQQQQFIQNQLTNQPQIPSSNQIPQDPQSFQQKQQNQNIQLQQNA
QQQQLQQQKNMTAQQKKSQQNQIQQQQNVQQQIPTQVNPNLQQQQLQQQSQQQQQLQQQL
QQQQTQQPASNLLQHNSQIQNPQNPNLVQNQLFVKQQQTQLQQTQQNKQFQPQSLHSSGH
SVGQKYNPAAEQPFQQQQNLAQQGKDSNLDSYGNPTPFNSQMNTQQQPQQQSGVTQHQQQ
PNSRQPPLQIQQQQQQINNRQNLHQSNNERNIHSSAHLTPSKNHANNSQQFQQQQAQQQQ
QQPNPNPNMQQQNLQHSGQNQQQQQIFNYQQNPHNPKYPQQQQPLPLNQYQQQFNSQGGL
NQSGSSQGGHQPSSLNSSAQLLSSQQQHVSQNPNNQQSQQQQHQFRLSQSGGQTNQIPSQ
NPQPNSLQQQQYNNMQQQQNKPFNPQQQIMNQQQANQNPSIGAQIQGQGNPQNIHQNKQM
VGSQTGLTDSQQQQQMIEQQQQAQQRQQKNKYLQDQAKQQQQNQMAQQQQQQQSIPNQNQ
YAQQQSMKSSNNIEYQRQSQGQGSQNPQQIHQQQQQMVQQQQVQQQQPLQPGNPQQVQQG
FPNQVNNQPPQNIQQSTPQRNGQMQIKVNPQLAQAATQPQIGTQGSQMQQGGIQNNQMQR
NTPQQGQKNAAGPQNQAVNGQIIQQGQQIKQNNIPINNNPNQMNPNPNQKQQQDLRHQQQ
LQEIAQQQQNPSNNIQYQKAQLQGMQQRQQNQEKINPNNQQQQYGPHYQKQQQPNQNINQ
VQKPQSQQQIPIHPNQITGQQQMANNPQNSSGLQQPNQQKNNLQNSNHLSSSNQYTPPQQ
QQQGIGGHTPSQIQTQNLQQIQPHNISENSNIYYQQQNSSFQQQLHVPQQMAQAQQYQKQ
QQHQAQQFQNQHSIPPNSIKQQNYNENIGYNNPEQQNLSRSYEDIQNRYNVQQQQQAQNM
PQNLTQNNYEQEQNVLKAKEYIRQACDQRGLGQQDVTNLFREIDNLVLRRKDEFIIDFEI
EYNQCLIIEVKLKKNNAFGSLRVDFDRQTLKYKIFSMNYDYSFTDKEREYDKIMDVIGVW
YKFQQQQNKDSQP


>TTHERM_00829330(gene)
ATGCTTTCCAAAAGAATACTCCAATCTCTTACCTAATCGTAATCATGTCCATCATCAAAG
TAGCTAGTTTGCTCAGAAAATATGAAAATTAATATAATAACATGGATTTATGAGGGTTAT
CTTAACGAATTTAACAAGCCTCGAGATCAATTATAAGATATTAATTAGAGGGCAATTGAA
AAGAAAGAATTTGAAAATTATCTTGAGTAAAAATTAAGCGATATCAGCATTAATTATGTT
GAGATATTTCAAAAAAATTTAATGAGCTGGCTTTATTCTTTCTTAACTAGAATAAATACT
TAAGCTAGCGAGTTAATTAAGAACAAAAACAATTAAGTGTAGCTCTTTGATTCAGTTAAG
AAAAGCAATCCACAAGCTTAGGAAATTATAGACTGTTTTATCTAAGCAAAGCCTGATCCA
TAAATCAAGGAATCAATCAGTAAGTTTATCACTTTAATTAGCCAACAGCAAGCACCAAAT
TAAGAAAACTAGAATTAACACTAATAAGCTAATAATCACCCATAGTATAATAACTACAAT
TAAGCAGGTAGAATGCAGTAAGGAGGTTTATCACAAAATACGCAATAAAATCCTTAGTAA
AGTAATCAACAAGTTAAATAAATTCCTCCATAGGGCTAGTAGCAGAATTAGTAAGACTAC
TAAGAAGGCTAGCCCTTGTTAAATAATGTACCAAATAAATAGTAATATTTAGATTAACAA
TAGTATTCAGCGCAAAAATAGTAGTAACAACCTTATAATACTAAAAATAACTCTATTTAA
CCTATCAATTAGCATCAAAATGGTTAACAGTAGCCATCTTAATAGCTTAATCCTTAGTAA
GCACATAATATGCAAATGTAGTAAAATATGCCTTAAAATGGACAAAAATACTCTATGAAC
GGTTAAATGAATCCCAATAGCAGCAATTTAGCACCTTCTAGTTCTTCAGCTGCTAATCCT
GGATAAACTTATAATCCATAAAACAAACAAATGAGTTCTGCTTAGCAACAACAATTATTA
TAATAGCAAAAGCAATACTAATAGAATACTCACGAATACACTGCCTCTAATAAGAATCCA
TAAAATCTGGCAAACTAAGGTTAAAGCAACCACTAAAATAATTAGTAAATACCTTCAAAC
TAGCACCATCCATCACAATATAGCTAGGGTCATATAAATGGGCCTAATTAAAACTAGCAG
CAATACTCTGCAAACTAAAGTCCAAGTTTGGCTAATAGAGCAGCAACTTAAGGATAGCCT
TAAACATAGAGCGACTAATCCAAATAAATGTCTTCTTATGCCTATCAATAGCAATAGTAG
TAAATTAACCAAGGATAACATAGCTAGAACCTTGGTAGATAAAACGGTTAGCCTCCATAA
ATTCCTAATCAATAATAGCAAAACTACTAAACTCAATCAAATTAATAGTAAAATCCATTA
TAGAAATAGCAACAACAATAACAACCACCTGCACATTTATAATAATAATAAGCTAAAAAT
ATTAATTAAAATAATTAACAGCAATTGCAGAGTTAGCAATCCCAATCATAATAAATGCAG
TAATAATAATAACAATAGCAATAGGGGTAATAGTAAGTCCTTTTGTAGTAATAAAAGTAA
GGTGGCTAACCAAATTAGATTCCTCCTTCAAATATGCAATAAAGAGCTCATTGGAATAAT
TAAAATAAAGCAGGTAACCCTCAATAAAATAATTTTTAAGTTAATCATTAAATGTAAGTC
AATCAAAATTAGAAAATGAATGGAGAAACTAACCCCTAAGTCCCAAAAGAAGAATAAGAT
TTGAACTCATAAAAAAATAATATGAATTCTCAGTAAAATATTTCACAACAAATGCAATAA
TAAAATTAAACTCAAATTCCACCAAATCACATTCAAAACCAAAATATGCAATAAACAGGT
GCTGGAGCTGCTAATATGAACCTTAATAATAGACAAAATATGATGGCAAATAGAGCATAA
AACTAATAAGGAAACCCTCAATAGGTGCAGCAAGGATCTAATTAATAGCAACAACCTCCT
AATCAGTAAGTACCACCAAACAATGTTCCAGGAAATTTCCATTAATAAAATGGGTAAAAT
TAAAACCCATCAAGCATGAACTAGTTATAAATTTAGCAGTAATAAAATGTTTAAAAATAA
AGAGGAAGAAGTAATAACTCAGCTGCAAATTTGAATCAGATGAATGAATAAAACTAATAA
ATTACTTCTAACTCACAACCACCCACAAATAATCCTTAATAAACAGGAATGTAATAGCAA
TTAAAGCCAAATCATTAAATTGCATAAAATATTTAACAATAGTAGCAATAAAATTTAAAA
CCTGGTCAGGTAATTCCAGGACAGCCGCAATAAGGCTAAAAAGGTTTTCCTAATTAACAA
TAATTATAACCTCTACCAAATGCGATATAAAATTAAAATATGCCTCCATCTGGGTATCCT
CATCTCTAATAAAATGGAAATGGACTAACTACAATAAGCTCACAAGGATCTAAAGTGAGA
ATCACTAAATCATAAACACCAGCACCAGATCAGATTTAGTAATAATAATTTTAACCACCT
CAAGTTGATCAATAATTACAGTAATAATAGTAAGAAATTTAATCTTAACCTCCTGCTGCT
GCAACAGCAGCTAATACTACTGCTCCTACTACTAATGTTGCTAACCCCACTAATGCTGCT
ACTACTACAACAAATATTACAACAACAGCAGCAACAACAACAACAACAACAACTGCAAAA
AGAAGAGGATCGTCATAAAATGTATAAAAAGAAGTACCTTTAAGGAAAAAAGCTTCTAAA
AGACAGCCAAGCAATTAAGTAAAAGAAGAATCTGATACAATTTAAACATAATCTTAAATT
TAATAACAGTAAGTACAGAACTAATCCAATCAAAGAGAATAGAATAATATCCCTAACGGA
GTTAGCGGATAGGGAGTGCAGTCAAATAATGCAGCAGGACCAGGGCAGGTAGGATAGACA
TCATCATTATTGGGAGCAGCACAAATTCCAACAACATTGCCAGTACCTTACAACTAATTT
CATTAGCAACAGAATCCTCAAAACTAAATGCCTCAGCCTATAGCGCCCAATCATCCTTAA
GTTTAAAGGAGTGCATATCCACAACAAGGAGAGCTAGCAGCTACCAATCATCCATCTGAA
ATATATTTCAAGTAAAAGTTAAAGGAAAAATTAGAAATACAAAAGAATTAAAATATTGAT
TAATTTGATCTCTTGACGCAATTTTTGAGAGATCCTTTTACCGATCCCATCACTGATTGC
TTCGTGATAGAAAACGATTTTTCTTTAAGAGATAATTAACTCAAAAATTAAATTAATACA
ATCACAAGTTAATTAAATAAAATTGAATAAAAAAGTAGAGAAAACTATCCTGTTAAACAA
TAGTAAATACCAGGAGGTTAATAGCAAATTCCTTAAGGTACTAATTACCTACAAAATTAA
CTCACATAACCTGATGCTAATGGTCACTAACCACCCTAAAATCCTCGAGTTATAGAGTAA
GAGTAAGATAGACCCCCTAAATTTAACTAAAATCCTGCTCTTATAAATTAAAGTCCCTCT
AAATAACTAACCTCTTTAAATCCCTAAGGAACTAAAGGGCAGCAGCCTATATAGCCTTAA
CTGGGTCAGAATGTTTAGTCTTAATTCCCTCCTCTGAACCAACCGAGCAGCTCCTAGATA
GAAACAGGTGCATAGCTTCCCACTAACTAATAAATTTAACCGTAGCCTGCTCCAACTCAA
CCTCCAATAAACAGTCGTCGTAAAAATACGAGCAACTCTATCAAATAAGGAGAACAGCCC
ACCAAAAAAGTTAAGGCTAATCCATAAACGAACCCTTCCCAAAAAAACGACTAGCAAGAT
TTGTAAAATCCTCCTCCTGCCCCAGTTTTAGGACCAGCGCAACCCACAGTATAAGGAAAT
CCCATACCTCCTCAAACTAACAACGTTTAAACTTCTTTATAAAACTAGCAGCAAATCAAG
TAACAAGGTTTAAAGCAACAATAACAATTTATCTAAAATTAATTGACAAATTAGCCTCAA
ATCCCAAGTTCAAATTAGATTCCTTAAGATCCACAATCCTTTTAACAAAAGTAACAAAAT
CAAAATATTTAGCTCCAATAAAATGCATAATAGTAGCAATTACAATAATAAAAAAACATG
ACTGCTCAATAAAAAAAGTCACAATAAAATTAGATATAATAATAACAAAATGTTTAATAA
TAAATACCAACTCAAGTTAATCCTAACTTATAGTAACAATAATTATAATAATAGTCTTAA
CAGCAACAATAGCTTTAACAATAATTACAACAACAGTAAACACAATAGCCAGCAAGTAAT
TTATTGTAGCATAATTCTCAAATACAAAATCCCTAGAATCCAAATTTAGTTTAAAATTAG
CTCTTTGTTAAATAGCAGCAAACATAACTATAATAAACTTAATAAAATAAATAATTTTAA
CCACAGTCTCTTCATTCTTCAGGTCATTCGGTAGGTTAAAAATACAACCCTGCTGCTGAA
TAGCCATTTTAATAATAATAAAATCTTGCTTAGTAAGGAAAAGACAGTAATTTGGATAGT
TATGGTAATCCTACTCCTTTTAACTCATAAATGAATACATAATAGTAACCTTAATAGCAA
AGTGGTGTAACACAGCATTAGTAACAACCTAATTCTAGATAGCCACCATTATAAATTTAA
CAGTAGTAATAGCAAATAAATAATAGATAGAATCTTCACTAATCTAATAATGAAAGAAAT
ATTCATTCAAGTGCTCATTTAACACCATCTAAAAATCATGCAAATAATAGTTAATAGTTC
TAACAATAATAAGCATAATAATAACAATAACAGCCAAATCCAAATCCAAATATGCAACAG
TAAAATTTACAGCATAGTGGATAAAATTAATAATAGCAATAAATATTTAACTACTAGCAA
AATCCACATAATCCAAAATATCCTTAATAATAGCAACCATTACCATTAAATTAATATTAA
CAGCAATTTAACTCTTAGGGTGGACTAAATCAATCTGGTAGTAGTTAGGGTGGACACTAG
CCTAGTAGCTTAAATTCTTCTGCATAGCTTTTATCTAGTTAACAATAGCATGTAAGCTAG
AATCCTAATAATTAGCAATCCCAATAGCAATAACATCAATTTAGATTGAGCTAGTCAGGA
GGATAAACTAACTAGATTCCATCTCAGAACCCGTAGCCAAATTCATTACAATAATAGCAA
TATAATAACATGTAATAATAGTAAAATAAACCATTTAATCCATAATAGCAAATAATGAAT
TAATAGCAGGCTAATTAAAATCCATCTATAGGAGCTCAGATTTAAGGTTAAGGAAATCCT
TAGAATATTCATCAAAATAAGTAAATGGTTGGAAGCTAGACAGGGTTGACAGATTCATAG
CAATAGTAATAAATGATTGAATAGCAGCAGCAAGCTTAGTAGAGATAATAGAAGAACAAA
TATTTATAAGATTAGGCTAAGTAGCAATAACAAAATTAAATGGCCTAATAACAATAACAA
CAACAGTCTATTCCCAATTAAAATTAATATGCACAATAATAATCTATGAAAAGTAGTAAT
AATATTGAGTACTAAAGATAATCTTAAGGATAGGGGAGTTAGAATCCTCAATAAATTCAT
TAACAATAACAACAAATGGTATAGTAATAACAAGTATAGTAGCAGTAACCTTTATAGCCT
GGCAATCCATAATAAGTGTAGCAAGGTTTCCCGAATTAAGTAAATAATTAACCACCTCAA
AATATTTAGTAATCAACACCTCAAAGAAATGGCTAAATGTAGATAAAGGTTAATCCATAA
TTAGCATAAGCAGCAACTCAACCATAGATTGGCACTTAGGGAAGCTAAATGTAGCAAGGA
GGCATATAAAATAACTAGATGCAAAGAAATACACCGCAATAAGGATAAAAGAATGCTGCT
GGACCATAAAATTAAGCAGTAAATGGTCAAATTATACAATAAGGATAGTAGATTAAGCAA
AATAATATTCCAATAAATAACAATCCAAACCAGATGAATCCCAATCCAAATTAGAAGTAA
TAGCAAGATCTAAGACACCAATAATAGTTATAAGAAATAGCATAGCAATAGCAAAACCCT
AGCAACAATATTTAATACCAAAAAGCTTAGTTATAAGGAATGCAATAAAGGTAATAAAAT
CAGGAAAAAATTAATCCAAATAATCAATAGTAATAATATGGGCCTCATTATTAGAAGTAA
CAACAGCCAAACTAAAATATAAACTAAGTGCAAAAACCTTAATCTTAGCAGTAGATTCCA
ATTCATCCAAATTAGATTACTGGATAATAGCAAATGGCTAATAACCCTTAAAATAGCAGT
GGACTACAATAGCCAAACTAATAAGTAAATTCATAATTAAAATTATAACAGGGATAAAAT
TAATAAAATTTTGCTTAGAAAAATAACCTCTAAAACTCTAATCATCTATCTTCAAGCAAT
TAATACACTCCTCCGTAACAGCAGTAATAAGGAATTGGAGGACACACACCATCTTAAATA
CAAACTTAAAACCTTTAACAAATTCAACCTCACAATATTTCAGAAAATAGTAATATTTAT
TACCAATAATAAAATTCTTCATTTTAATAGCAATTGCATGTGCCCTAATAGATGGCACAA
GCGCAATAATACTAGAAACAATAGTAGCACTAAGCTTAGCAGTTTCAAAATTAACATTCA
ATTCCCCCAAATTCAATTAAACAATAAAATTATAATGAAAATATAGGATACAATAATCCT
GAATAACAGAACCTAAGTAGAAGCTACGAAGATATTTAAAATAGATATAATGTGCAATAA
CAGCAACAAGCACAAAATATGCCTTAAAATTTAACTCAGAATAATTATGAATAAGAATAA
AATGTATTAAAAGCAAAGGAATACATAAGACAAGCCTGTGATTAGAGAGGTTTGGGACAA
CAAGATGTTACAAATTTATTCAGAGAGATTGATAACTTAGTTTTAAGAAGAAAAGATGAA
TTCATTATTGATTTTGAAATAGAATATAATTAGTGTTTGATTATTGAGGTAAAACTTAAA
AAGAATAATGCATTTGGTTCTCTCCGAGTCGATTTTGACAGACAAACACTTAAATATAAA
ATTTTTTCCATGAATTATGATTATAGCTTCACTGATAAAGAAAGGGAATATGATAAGATC
ATGGATGTAATTGGAGTATGGTACAAGTTCTAATAATAGCAGAATAAAGACAGCTAACCT
TGA