Identifiers and Description

Gene Model Identifier

TTHERM_00052180

Standard Name

MITS1 (MED31-interacting Tetrahymena specific protein 1)

Aliases

PreTt11398 | 3.m01834 | 3824.m03152

Description

hypothetical protein; Possible subunit of Tetrahymena Mediator complex. Co-purified with Med31 in AP-MS experiments.

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.3%

TetraMine Data

TTHERM_00052180

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_01550.19.997093137033517e-262hypothetical protein (1085 aa)

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:31280994: Garg J, Saettone A, Nabeel-Shah S, Cadorin M, Ponce M, Marquez S, Pu S, Greenblatt J, Lambert JP, Pearlman RE, Fillingham J (2019) The Med31 Conserved Component of the Divergent Mediator Complex in Tetrahymena thermophila Participates in Developmental Regulation. Current biology : CB 29(14):2371-2379.e6

Sequences

>TTHERM_00052180(coding)
ATGGATAAAATTGAGTACTCACTTTATAAAGTTTGTTCTAAAATCATTGCACATACTCAA
AATGAACTCCCAACTTAGCAAAATGTTCACGACAATACTTAAGCAAAAGATTTATGTGAT
TCCGTTATGCTAAAATTTAATGAATTCGATCAGCTTTTCGATAGATTAACAAATATTGTT
TAATATTTGCAATACGATTAGCCTGAAGAGAAGAAAATGATAGATATTGAGAGATAGATT
TAAGAACATCAAAATGAAATTTGGAATTGTGGTGAAAATTTAAATAAACTGCATCACGAA
TTCATTAATAGTCCTTGGGTAAATATGGAAAGTGTTAATTTAATGTATGGAAGAAATGGT
TAAGTTAAAATGGAGTTATTGGATGGGTATAATTTAGGGATGGACTACAAAACTAAACAA
TAGGAGAAAAAACATTTAATGAGAAAAAAGCTTTTAAGCATGAAAAAACCTCCAAAAGTA
GATAAAATAAAGCTTAAAGATGATAGATGTATTGTGAAAACAGATATATACTAAATAAAC
TATGATTTAATTTATGACTAAGAAACTGATACTTTCAATTGGAAAATCCCTAGAACAAAG
GATATTTAGATATCTGATAATGGTTTATCATATTTGTAAAACTTCCTAAAAGATGAAAAA
AGTAAAAAGGATATTTAAACTGCTTTGGATCAGGTTAACAAATCTATAATTCAATTAAAA
AAAGAAATAATTGCTTAGACTAAAGAAAGAAAGAAGCGCTAGTAATTGTTTGAAGCTAAG
AAGGAGGTGTAGGAAGACCTTATTAAAACAGAGCACTTCAATGTTAAATAAGAGGCATAA
TCTTAAAATGTAAAATTAGAACATTATTCGTAACCTATGAATGTGAAATCCGAATATAAA
GGAAATGATGCTTTAGCTGAAGATAGTAATATTGAAGAAGAATACAACTACTAGATACTT
TGCAATAAATATGAGATGATGGTTTCTTATGTATTTTGCTTTATAGATTAGAAAATTAAA
ACCTTATTCTCAGATTAAGTTTTGGAGATTTTATAGAAATAGGACAAAGAAAACTTACAA
AAAAAATTTGGGCCAGAGGTTGTTTATCTTCAAAAAAAATCTGACATTAAAGATGAATTG
AAATTCAACTACGTATAGATTCGTTTCAAGCCTTAAACTGCGATGCTTTAAACTGTCTTA
AAATAGGAGAATTTGATCAAAAACAAAGCAGAAAATAATATCACATAAACATCAATTTTC
ATAGAACACATTTCTTACGACACTAATACCTACTATTAATTTATACTTTCCTAAGAGAAA
ATTAATTTTTATCGTTAAATTAGAGCTAAATCTCATTAAGAGCAAAAGGAAATTATTGAA
AAAATACAATATTATAAACCAAGCCAATTAATTAAGGAAAAAATTAACTATAAGAATTTA
ATTATTTAAGAAGCTATCAAAAATGATTTGCTTCCTAAATAAAGTTTCTCTTTAACACCG
TTCGATACTATTTACATTAAATCTAATATTACCCTCAGCTAAATTGACTCTACTCTACTG
AGGCCTTTCATAAATTTGGAGGACTAAAATTAAATTTAGGTGGATTCTTTATTTTTAATT
CATAAACCCAAAGAATTAATAATTTAACCAGAAAATGTAGATAATCCTTCAAACTCTGAT
AACGTGAGTTATTTAAGAGTTGTGATAGGAGATAAAATAGATTTAGAAATTATACTCTAG
TAGTACAGAGTAATCATGCTTTAGCAATTTTTTATTTCAAACTATAAGCTAAGCTAGAGT
CTGCATGATGAAAATTCAATGCATTTAGAAGTTTATGATGAATAGTAAGCTAGCAACATG
GTTTTACTAATTAGACAAAAAAGATAGTTATATGATGAGGACATTAAATAAATTAGTATA
AACAAAATATAAAGCAAGTATTTAACCCAAGCTGTATTTTAGCTTTAAAATCATCCTCTA
ATAAAAAACATAATCTACTAGGTCTTGATTTGTGTTAGGATAACCTGTGATGACCTAGAC
AGTAAAGACGATAAGGAGATATACTAAATAATAATACCATATCTGACAGATAAGCAGCAC
TACATAATTTATAATAGTTTAAACGAAGATATTATTGAATTAGATTCATAAAAGGAGCAA
GAATTAGATGAATTGATATAGGATTTGCAAAGAAAAGAGCATATTATTTAGAATTTTGTA
AACACTGTTTATATAGCACAAGCTGTTTAAAAAAATATTTTGCACTCCTAATTTAGAGCA
ATAAGTTAGGAATAAAACAGCGACTACAGTTAAATTACTATTGAGTGTAGATTAAAAGAT
GAGTTAAATTCAGATAAGCCAATTAAAATTTACATATAAAAAAACTTTCATATAAATTTG
GAATATAACTTTGGTGAATTGAGAAACTAATGCAAAACAGAGGAAATACCGAGAAACTAA
AGTTTATCTAGCTTCTACAAACAATTCACTTTTAATTTAGATTTAAATATCTAAAAATCA
TTGAAAGATATATATTCCAGGTATAATTACTTGAGTGATGATAGAACAAGGATTATAAAA
GAATTCCTCAAATTGAAAATTTCAAATGATGAATGGTTTACTCAACACAATTTGAAAACT
AGACCTGAAACTATTGTACATCACCCTAATTAGCAACACACAGGAAGTAATTAAGGTATA
TAACAAGGAATTAACGGTTAATAGAATGGTTTAAATCATTATAATCAATAAAGGCCAAAT
TAAAACCAATTCTAAAATAATTCTATATAGTAATAAAATAACTCTTAGGGTTTACCAGCA
AATCAGTAAGTAGTGGGTTAAGGAAATCATTAATAATCTGGAAATCAATAACGCCCATAT
GCTTAGAATTCTAATTTTAATCAATAATAATAACCCTAATAGTCATAACCTGGGACATAA
GTTTAATAAAATGGAGCTATGAATAATAGTTATGGTTAGCAAACAGGATAATCTACCTAA
AGAAATCCTTAACAGTATTACTAAAATTAATAATAGTATGGAAATAATAATTACAATAAT
TAAGCATAATAGCAATAAAATCCTAACTAATAAGGTGTTGGCTAGTAATCTGGTGCAAAT
AATTATGCTCACATGAATGGAGCTTAGAACTCTTCGTATAACTAGTAATAATATTAAAAT
TACCAACCAAATAGTAACAGACCTAATTGA


>TTHERM_00052180(protein)
MDKIEYSLYKVCSKIIAHTQNELPTQQNVHDNTQAKDLCDSVMLKFNEFDQLFDRLTNIV
QYLQYDQPEEKKMIDIERQIQEHQNEIWNCGENLNKLHHEFINSPWVNMESVNLMYGRNG
QVKMELLDGYNLGMDYKTKQQEKKHLMRKKLLSMKKPPKVDKIKLKDDRCIVKTDIYQIN
YDLIYDQETDTFNWKIPRTKDIQISDNGLSYLQNFLKDEKSKKDIQTALDQVNKSIIQLK
KEIIAQTKERKKRQQLFEAKKEVQEDLIKTEHFNVKQEAQSQNVKLEHYSQPMNVKSEYK
GNDALAEDSNIEEEYNYQILCNKYEMMVSYVFCFIDQKIKTLFSDQVLEILQKQDKENLQ
KKFGPEVVYLQKKSDIKDELKFNYVQIRFKPQTAMLQTVLKQENLIKNKAENNITQTSIF
IEHISYDTNTYYQFILSQEKINFYRQIRAKSHQEQKEIIEKIQYYKPSQLIKEKINYKNL
IIQEAIKNDLLPKQSFSLTPFDTIYIKSNITLSQIDSTLLRPFINLEDQNQIQVDSLFLI
HKPKELIIQPENVDNPSNSDNVSYLRVVIGDKIDLEIILQQYRVIMLQQFFISNYKLSQS
LHDENSMHLEVYDEQQASNMVLLIRQKRQLYDEDIKQISINKIQSKYLTQAVFQLQNHPL
IKNIIYQVLICVRITCDDLDSKDDKEIYQIIIPYLTDKQHYIIYNSLNEDIIELDSQKEQ
ELDELIQDLQRKEHIIQNFVNTVYIAQAVQKNILHSQFRAISQEQNSDYSQITIECRLKD
ELNSDKPIKIYIQKNFHINLEYNFGELRNQCKTEEIPRNQSLSSFYKQFTFNLDLNIQKS
LKDIYSRYNYLSDDRTRIIKEFLKLKISNDEWFTQHNLKTRPETIVHHPNQQHTGSNQGI
QQGINGQQNGLNHYNQQRPNQNQFQNNSIQQQNNSQGLPANQQVVGQGNHQQSGNQQRPY
AQNSNFNQQQQPQQSQPGTQVQQNGAMNNSYGQQTGQSTQRNPQQYYQNQQQYGNNNYNN
QAQQQQNPNQQGVGQQSGANNYAHMNGAQNSSYNQQQYQNYQPNSNRPN


>TTHERM_00052180(gene)
ATGGATAAAATTGAGTACTCACTTTATAAAGTTTGTTCTAAAATCATTGCACATACTCAA
AATGAACTCCCAACTTAGCAAAATGTTCACGACAATACTTAAGCAAAAGATTTGTATTAA
TCTATTATTTAAATTATTTTAAGTTCAAAAAGAGACTAAATAGATAATTAAAAATGCTAC
ATTTAACAAAATATAATTGTATTAATATGATAAACTCATTAGTGGTATTTTTATGAAAAA
AGATGTGATTCCGTTATGCTAAAATTTAATGAATTCGATCAGCTTTTCGATAGATTAACA
AATATTGTTTAATATTTGCAATACGATTAGCCTGAAGAGAAGAAAATGATAGTATACTAT
TCGATAGTTTATTTTAATTGATTTAAATAAAAGTACTATGAGCGAAATAAAATAAAATAT
ATTGTTTGCATGTTTATAATGCAGATAGAGCATTTAAACTAGCTTTTTTATTTTATTTTA
AAAGGATATTGAGAGATAGATTTAAGAACATCAAAATGAAATTTGGAATTGTGGTGAAAA
TTTAAATAAACTGCATCACGAATTCATTAATAGTCCTTGGGTAAATATGGAAAGTGTTAA
TTTAATGTATGGAAGAAATGGTTAAGTTAAAATGGAGTTATTGGATGGGTATAATTTAGG
GATGGACTGTAATTTTAATTCTTTTAGGCTTAAAAGATATCTTAATTATTTTTATTTATA
ACATTTAAAAAGACAAAACTAAACAATAGGAGAAAAAACATTTAATGAGAAAAAAGCTTT
TAAGCATGAAAAAACCTCCAAAAGTAGATAAAATAAAGTAGTTTTTTGTTTTTGCAATCT
GAAAACGTAAACATTTTAATGTATTTAATTAAATGCAGGCTTAAAGATGATAGATGTATT
GTGAAAACAGATATATACTAAATAAACTATGATTTAATTTATGACTAAGAAACTGATACT
TTCAATTGGAAAATCCCTAGAACAAAGGATATTTAGATATCTGATAATGGTTTATCATAT
TTGTAAAACTTCCTAAAAGTAAATTTTATGTTTGACAAAAAAAATATTGATTTCTTCTCT
TTTTTTAAGGATGAAAAAAGTAAAAAGGATATTTAAACTGCTTTGGATCAGGTTAACAAA
TCTATAATTCAATTAAAAAAAGAAATAATTGCTTAGACTAAAGAAAGAAAGAAGCGCTAG
TAATTGTTTGAAGCTAAGAAGGAGGTGTAGGAAGACCTTATTAAAACAGAGCACTTCAAT
GTTAAATAAGAGGCATAATCTTAAAATGTAAAATTAGAACATTATTCGTAACCTATGAAT
GTGAAATCCGAATATAAAGGAAATGATGCTTTAGCTGAAGATAGTAATATTGAAGAAGAA
TACAACTACTAGATACTTTGCAATAAATATGAGATGATGGTTTCTTATGTATTTTGCTTT
ATAGATTAGAAAATTAAAACCTTATTCTCAGATTAAGTTTTGGAGATTTTATAGAAATAG
GACAAAGAAAACTTACAAAAAAAATTTGGGCCAGAGGTTGTTTATCTTCAAAAAAAATCT
GACATTAAAGATGAATTGAAATTCAACTACGTATAGATTCGTTTCAAGCCTTAAACTGCG
ATGCTTTAAACTGTCTTAAAATAGGAGAATTTGATCAAAAACAAAGCAGAAAATAATATC
ACATAAACATCAATTTTCATAGAACACATTTCTTACGACACTAATACCTACTATTAATTT
ATACTTTCCTAAGAGAAAATTAATTTTTATCGTTAAATTAGAGCTAAATCTCATTAAGAG
CAAAAGGAAATTATTGAAAAAATACAATATTATAAACCAAGCCAATTAATTAAGGAAAAA
ATTAACTATAAGAATTTAATTATTTAAGAAGCTATCAAAAATGATTTGCTTCCTAAATAA
AGTTTCTCTTTAACACCGTTCGATACTATTTACATTAAATCTAATATTACCCTCAGCTAA
ATTGACTCTACTCTACTGAGGCCTTTCATAAATTTGGAGGACTAAAATTAAATTTAGGTG
GATTCTTTATTTTTAATTCATAAACCCAAAGAATGTAAATTTTAATTTTGTTTTTCTTTT
ATAAATCAATCAATAAATAATAGTAATAATTTAACCAGAAAATGTAGATAATCCTTCAAA
CTCTGATAACGTGAGTTATTTAAGAGTTGTGATAGGAGATAAAATAGATTTAGAAATTAT
ACTCTAGTAGTACAGAGTAATCATGCTTTAGCAATTTTTTATTTCAAACTATAAGCTAAG
CTAGAGTCTGCATGATGAAAATTCAATGCATTTAGAAGTTTATGATGAATAGTAAGCTAG
CAACATGGTTTTACTAATTAGACAAAAAAGATAGTTATATGATGAGGACATTAAATAAAT
TAGTATAAACAAAATATAAAGCAAGTATTTAACCCAAGCTGTATTTTAGCTTTAAAATCA
TCCTCTAATAAAAAACATAATCTACTAGGTCTTGATTTGTGTTAGGATAACCTGTAATTT
TGGTTAATTATTATGCTAAATAAATGTTTTAACTATTTATGTATTGTAAAGGTGATGACC
TAGACAGTAAAGACGATAAGGAGATATACTAAATAATAATACCATATCTGACAGATAAGC
AGCACTACATAATTTATAATAGTTTAAACGAAGATATTATTGAATTAGATTCATAAAAGG
AGCAAGAATTAGTAATGATTAATTTTTATAAAATAAAGTAAAATAAAAAACATATTTATT
TATCTTTACTATTAAATAAAAAGGATGAATTGATATAGGATTTGCAAAGAAAAGAGCATA
TTATTTAGAGTATTTTATTCCAAAAATATTTTTATTTAAGTTTTATTTTAATTAAAAGAT
TTTGTAAACACTGTTTATATAGCACAAGCTGTTTAAAAAAATATTTTGCACTCCTAATTT
AGAGCAATAAGTTAGGAATAAAACAGCGACTACAGTTAAATTACTATTGAGTGTAGATTA
AAAGATGAGTTAAATTCAGATAAGCCAATTAAAATTTACATATAAAAAAACTTTCATATA
AATTTGGAATATAACTTTGGTGAATTGAGAAACTAATGCAAAACAGAGGGTAAATAAATA
TAATATTTGCTGCATTCTTGATTATTTATTTTTTAATTTATTTAATCATTTATTTCAATT
AATATTTACTTTCATATTTTTAATTTATAAAAAAATTAAATTGGTTTTTTAAAATATTTA
TTTTTTTTTTAAAAACAAATTGCAGAAATACCGAGAAACTAAAGTTTATCTAGCTTCTAC
AAACAATTCACTTTTAATTTAGATTTAAATATCTAAAAATCATTGAAAGATATATATTCC
AGGTATAATTACTTGAGTGATGATAGAACAAGGATTATAAAAGAATTCCTCAAATTGAAA
ATTTCAAATGATGAATGGTTTACTCAACACAATTTGAAAACTAGACCTGAAACTATTGTA
CATCACCCTAATTAGCAACACACAGGAAGTAATTAAGGTATATAACAAGGAATTAACGGT
TAATAGAATGGTTTAAATCATTATAATCAATAAAGGCCAAATTAAAACCAATTCTAAAAT
AATTCTATATAGTAATAAAATAACTCTTAGGGTTTACCAGCAAATCAGTAAGTAGTGGGT
TAAGGAAATCATTAATAATCTGGAAATCAATAACGCCCATATGCTTAGAATTCTAATTTT
AATCAATAATAATAACCCTAATAGTCATAACCTGGGACATAAGTTTAATAAAATGGAGCT
ATGAATAATAGTTATGGTTAGCAAACAGGATAATCTACCTAAAGAAATCCTTAACAGTAT
TACTAAAATTAATAATAGTATGGAAATAATAATTACAATAATTAAGCATAATAGCAATAA
AATCCTAACTAATAAGGTGTTGGCTAGTAATCTGGTGCAAATAATTATGCTCACATGAAT
GGAGCTTAGAACTCTTCGTATAACTAGTAATAATATTAAAATTACCAACCAAATAGTAAC
AGACCTAATTGA