Identifiers and Description

Gene Model Identifier

TTHERM_00317440

Standard Name

MFE1 (Fusion of peroxisomal multifunctional oxydation protein and 2-enoyl-CoA hydratase)

Aliases

PreTt21044 | 31.m00346 | 3687.m00148

Description

Fusion of peroxisomal multifunctional oxydation protein and 2-enoyl-CoA hydratase

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( PF08659 ) KR domain
  • ( TIGR02415 ) acetoin reductases
  • ( TIGR02685 ) pteridine reductase
  • ( TIGR01500 ) sepiapterin reductase
  • ( TIGR01829 ) acetoacetyl-CoA reductase
  • ( PF02036 ) SCP-2 sterol transfer family
  • ( TIGR01963 ) 3-hydroxybutyrate dehydrogenase
  • ( TIGR01832 ) 2-deoxy-D-gluconate 3-dehydrogenase
  • ( PF01370 ) NAD dependent epimerase/dehydratase family
  • ( TIGR01830 ) 3-oxoacyl-[acyl-carrier-protein] reductase
  • ( TIGR03206 ) 2-hydroxycyclohexanecarboxyl-CoA dehydrogenase
  • ( TIGR03325 ) cis-2,3-dihydrobiphenyl-2,3-diol dehydrogenase
  • ( TIGR01831 ) 3-oxoacyl-(acyl-carrier-protein) reductase, putative
  • ( PF00106 ) oxidoreductase, short chain dehydrogenase/reductase family

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 11.8%

TetraMine Data

TTHERM_00317440

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_08350.19.997093137033517e-262acyl carrier protein reductase
(452 aa)
OxytrichaContig22293.0.g199.997093137033517e-262short chain dehydrogenase
DictyBaseDDB_G02912476.998828886836733e-138mfeA on chromosome: 6 position
383676 to 385001
WormBaseWBGene000009916.000667945664035e-116locus:dhs-28 status:Confirme
d UniProt:Q21481 protein_i
d:CCD70982.1
SGDYKR009C1.9998944264638884e-101FOX2 Multifunctional enzyme of
the peroxisomal fatty acid be
ta-oxidation pathway; has 3-hy
droxyacyl-CoA dehydrogenase an
d enoyl-CoA hydratase activiti
es
Stentor CoeruleusSteCoe_109646.991989996645917e-56

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00317440(coding)
ATGTCTTAAATTAGATTCGATAACAGAGTTGTCATCGTTACTGGTGCTGGTAATGGTTTA
GGTCGTGAATACGCTCTTTACTTCGCCTCCAAGGGTGCTAAGGTTGTTGTTAACGACTTA
GGTGTCACTCACTCTGGTGAAGGTACCAAGACCAACCCCGCTTAAAAGGTCGTTGATGAA
ATCAAGGCTGCTGGTGGTGTTGCTGTTGCTAACACTGACTCCGTCGAATTCGGTGACAAG
ATCGTTAAGACTGCCATCGATGCCTTCGGTAAGGTTGATGTCATCATTAACAATGCTGGT
ATCCTCAGAGATATCACTTTCTAAAAGATGACCGATCTTGACTGGAACCTCATCATGAAG
GTCCACGTTAACGGTACCTACTCAGTTACTCGTGCTGCTTGGGATATTATGAGACAACAA
GGATACGGTAGAATCATCAACACTGGTTCTGGTTCTGGTATCTATGGTTCTTTCGGTCAA
GCTAACTACTCTACCGCTAAGTTGGGTATCCATGGTTTAACTCTTACTTTGGCCAAGGAA
GGTGAAAAGAGAAACATTAGAGTCAACACTATTGCTCCCATCGCTGCCTCCAGAATGACT
GAAACTGTCCTCCCCAAGGAAGCTTTAGCTAATTTGGACCCCAAGCACATTGTTCCTCTC
GTTGGTTACCTTGCTCACGAATCATGCGAAGAAACTGGTTCCCTCTTCGAAATTGCCGCT
GGTTTCATTGCTAAGCTCAGATGGTAGAGAGCTGCTGGTGCTTTATTCGATCTCCCCTAC
ACTGCTGAAGAAGTCAGAGACAGATGGAACACTATCTGCGATTTCGAAAAGAACCCCGAA
TACCCCACTGCTACCAGTGATACTTTCGCTAAGGTCAATGAAAACGTTGAAAGAATCCAA
CTCAAGAGGGAAGAAGCTGCTAAGAAAGCTGCCACCACTGCCCCCGCTGCTGTTGATAGT
CCCTACAAATCCGATTAAATCTTCACCATGATGAAGGTTTTCCTCGAACGTGGAGAAGGT
ACCAAGTTAGTCAAGGACCTCCAAGCTGTCTACGGTTTCAACATTGTTGAAAAGAAGAAT
GGTCCCGTCAAGAGAGCTTACACTATTGACTTGAAGAACGGTCAAGGTGCAGTTGTCTTC
TAAGAAGCCAAGACTGCTGATGCCACCTTCACCATGATTGATGGTGACTTCGAATAAGTC
TGCTTAGGTAAACTCAACCCCAACAATGCCTTCATGACTGGTAAGATGAAAATCAAGGGT
CACATGGGTAAGGCTACCAAGTTCACCCCTGCTCTTTTCCCTCCCCCCACCCCTGAAAAT
ATTGCTAAGTACACTCCTGCTAAGCTTTGA


>TTHERM_00317440(protein)
MSQIRFDNRVVIVTGAGNGLGREYALYFASKGAKVVVNDLGVTHSGEGTKTNPAQKVVDE
IKAAGGVAVANTDSVEFGDKIVKTAIDAFGKVDVIINNAGILRDITFQKMTDLDWNLIMK
VHVNGTYSVTRAAWDIMRQQGYGRIINTGSGSGIYGSFGQANYSTAKLGIHGLTLTLAKE
GEKRNIRVNTIAPIAASRMTETVLPKEALANLDPKHIVPLVGYLAHESCEETGSLFEIAA
GFIAKLRWQRAAGALFDLPYTAEEVRDRWNTICDFEKNPEYPTATSDTFAKVNENVERIQ
LKREEAAKKAATTAPAAVDSPYKSDQIFTMMKVFLERGEGTKLVKDLQAVYGFNIVEKKN
GPVKRAYTIDLKNGQGAVVFQEAKTADATFTMIDGDFEQVCLGKLNPNNAFMTGKMKIKG
HMGKATKFTPALFPPPTPENIAKYTPAKL


>TTHERM_00317440(gene)
ATGTCTTAAATTAGATTCGATAACAGAGTTGTCATCGTTACTGGTGCTGGTAATGGTTTA
GGTCGTGAATACGCTCTTTACTTCGCCTCCAAGGGTGCTAAGGTTGTTGTTAACGACTTA
GGTGTCACTCACTCTGGTGAAGGTACCAAGACCAACCCCGCTTAAAAGGTCGTTGATGAA
ATCAAGGCTGCTGGTGGTGTTGCTGTTGCTAACACTGACTCCGTCGAATTCGGTGACAAG
ATCGTTAAGACTGCCATCGATGCCTTCGGTAAGGTTGATGTCATCATTAACAATGCTGGT
ATCCTCAGAGATATCACTTTCTAAAAGATGACCGATCTTGACTGGAACCTCATCATGAAG
GTCCACGTTAACGGTACCTACTCAGTTACTCGTGCTGCTTGGGATATTATGAGGTAATTA
ATTTCAACATTTATATAATTCTCATAGTACATTCCCTGACTTTGTTTGACTAGTTAGTTA
AGGATTTCAAATTAATTTCACAAAGCACTCAATTGATTGCTGTTTAATTGTAGTAAATCA
ATCTACATCATACAAGAATCCAATTAAAATAAAATTTTAAATAGCAAAAATAGTTAGATG
GACAAAACAAAAACAAAATTCTAACTGAATTATTTAAAAATGAGCCTAATATTTAATAAT
TATTTTAAATTTAAATTAGACAACAAGGATACGGTAGAATCATCAACACTGGTTCTGGTT
CTGGTATCTATGGTTCTTTCGGTCAAGCTAACTACTCTACCGCTAAGTTGGGTATCCATG
GTTTAACTCTTACTTTGGCCAAGGAAGGTGAAAAGAGAAACATTAGAGTCAACACTATTG
CTCCCATCGCTGCCTCCAGAATGACTGAAACTGTCCTCCCCAAGGAAGCTTTAGCTAATT
TGGACCCCAAGCACATTGTTCCTCTCGTTGGTTACCTTGCTCACGAATCATGCGAAGAAA
CTGGTTCCCTCTTCGAAATTGCCGCTGGTTTCATTGCTAAGCTCAGATGGTAGAGAGCTG
CTGGTGCTTTATTCGATCTCCCCTACACTGCTGAAGAAGTCAGAGACAGAGTAATTCATT
ATTTTCATATATATTAAATAGCAAATCATTCAAACTATATACAAGCCGATAATCGTTAAT
CCCCTTAACTCTCTTCTACTTTTAATTAACAAATAAAAATAAATTTCTTAAATTCTTGCA
AATCTTCTAGAAGATTTAATTGAAAAACTAACCAAATAAGATGACATCATTCATTCATAT
ATGTATAGTATAAAAGATAAGTTTTCACATTGCAAATAATTTTATGAAATATAAAAGCAT
TCCATAAAAAAAATTATAAAAGCAAATAATATTTTAAAAAAAAGTGAATGAGAATTGATT
AAATAGATTGAAAATAGTTTGGAATAGATTTTAATAAAATGATATTATTATTAAATTGTA
TTTCTTAAATTAAATTAGTGGAACACTATCTGCGATTTCGAAAAGAACCCCGAATACCCC
ACTGCTACCAGTGATACTTTCGCTAAGGTCAATGAAAACGTTGAAAGAATCCAACTCAAG
AGGGAAGAAGCTGCTAAGAAAGCTGCCACCACTGCCCCCGCTGCTGTTGATAGTCCCTAC
AAATCCGATTAAATCTTCACCATGATGAAGGTTTTCCTCGAACGTGGAGAAGGTACCAAG
TTAGTCAAGGACCTCCAAGCTGTCTACGGTTTCAACATTGTTGAAAAGAAGAATGGTCCC
GTCAAGAGAGCTTACACTATTGACTTGAAGAACGGTCAAGGTGCAGTTGTCTTCTAAGAA
GCCAAGACTGCTGATGCCACCTTCACCATGATTGATGGTGACTTCGAATAAGTCTGCTTA
GGTAAACTCAACCCCAACAATGCCTTCATGACTGGTAAGATGAAAATCAAGGGTCACATG
GGTAAGGCTACCAAGTTCACCCCTGCTCTTTTCCCTCCCCCCACCCCTGAAAATATTGCT
AAGTACACTCCTGCTAAGCTTTGA