Identifiers and Description

Gene Model Identifier

TTHERM_000365339

Standard Name

MELG3 (Meiotic nuclear ELonGation 3)

Aliases

None

Description

transmembrane protein putative. Required for the elongation of the micronucleus and the attachment of telomeres to the nuclear tip during meiotic prophase. MELG3 corresponds to transcript gene_000025916 in FGD

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 15%

TetraMine Data

TTHERM_000365339

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

No Data fetched for Homologs

General Information

Paragraph NoGene NameParagraph Text
144MELG3Melg3 protein interacts with Tass1 (co-IP) and localizes to the telomeric tip of the micronucleus during meiotic prophase. In a melg3 deletion mutant, meiotic homologous chromosome pairing and bivalent formation are moderately reduced.

Associated Literature

  1. Ref:33172984: Tian M, Agreiter C, Loidl J (2020) Spatial constraints on chromosomes are instrumental to meiotic pairing. Journal of cell science 133(22):

Sequences

>TTHERM_000365339(coding)
ATGACTTTCATCTCTGAACCCCAAGCTAATCTGTTTTTTAAGCTAATTTAACTTTTCAAT
TAGCAAAAGATTGAGAAGAAATCCAAAGTTTTCATATATTTTATCAGACTAACTTGTTGT
ACTTAAGATAATAATTATTTTGGCTATTTCATCATATTCTAAATCATTTTAGAGTATCTT
TTGTAAAAGATCATTTTGATTAGATTTTTAAATAATTTAAAATTTATATTTCTCAGTTTA
ATACCAGATATCTTTCATAGTATTAATGTTGATATTCCTTATAGGCCACTAAAACCCATC
TAATATGTAATAGATTATTCCAAAGCGTTATCGAAGTAATTTTTTTTCACTGTTCTAATT
TTTGGTTTTTTCATTAGAGTTGGTTCCGTAATTACTTTCTATTTCCTTAAGGATATTCTT
ATATGTGTCATCTTAGCTTTAAATAGGTGA


>TTHERM_000365339(protein)
MTFISEPQANLFFKLIQLFNQQKIEKKSKVFIYFIRLTCCTQDNNYFGYFIIFQIILEYL
LQKIILIRFLNNLKFIFLSLIPDIFHSINVDIPYRPLKPIQYVIDYSKALSKQFFFTVLI
FGFFIRVGSVITFYFLKDILICVILALNR


>TTHERM_000365339(gene)
ATGACTTTCATCTCTGAACCCCAAGCTAATCTGTTTTTTAAGCTAATTTAACTTTTCAAT
TAGCAAAAGATTGAGAAGAAATCCAAAGTTTTCATATATTTTATCAGACTAACTTGTTGT
ACTTAAGATAATAATTATTTTGGCTATTTCATCATATTCTAAATCATTTTAGAGTATCTT
TTGTAAAAGATCATTTTGATTAGATTTTTAAATAATTTAAAATTTATATTTCTCAGTTTA
ATACCAGATATCTTTCATAGTATTAATGTTGATATTCCTTATAGGCCACTAAAACCCATC
TAATATGTAATAGATTATTCCAAAGCGTTATCGAAGTAATTTTTTTTCACTGTTCTAATT
TTTGGTTTTTTCATTAGAGTTGGTTCCGTAATTACTTTCTATTTCCTTAAGGATATTCTT
ATATGTGTCATCTTAGCTTTAAATAGGTGA