Identifiers and Description

Gene Model Identifier

TTHERM_00289290

Standard Name

MELG2 (Meiotic nuclear ELonGation 2)

Aliases

PreTt25961 | 26.m00313 | 3688.m00106

Description

Required for the elongation of the micronucleus during meiotic prophase

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.3%

TetraMine Data

TTHERM_00289290

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_09333.11.0002335610448659e-38hypothetical protein (157 aa)

General Information

Paragraph NoGene NameParagraph Text
142MELG2Melg2 protein localizes to the micronucleus during meiotic prophase. In a melg2 deletion mutant, homologous chromosome pairing and bivalent formation are strongly reduced, and the arrangement of centromeres and telomeres within the meiotic nucleus is abnormal.

Associated Literature

  1. Ref:33172984: Tian M, Agreiter C, Loidl J (2020) Spatial constraints on chromosomes are instrumental to meiotic pairing. Journal of cell science 133(22):
  2. Ref:26688337: Kataoka K, Mochizuki K (2015) Phosphorylation of an HP1-like Protein Regulates Heterochromatin Body Assembly for DNA Elimination. Developmental cell 35(6):775-88

Sequences

>TTHERM_00289290(coding)
ATGCTTATTATGGAAACTCCTCAATTTTCAGCAAAAGATAAAAATGGATAAAATTCACAA
TCTAGTTTTCATTAAGAAATTCTTCGTGCTCCAAAGAAAAATTAAACTAAAAAGACGCTT
TAAATAAAAAAAAATATTATCTTGACATCAGATGTAGCTCATGAGCTCAGAAAAATTAAT
TTTAATGATTCTCCTTTGATGAATTAGTTTATTCTTATGCATGCTAGAGTATTTTAAGAT
AGTAAAACTCCTTAGACTCCCATTAAAAACTATAGAGAAACGCTTCATGATAATAATCTG
TTTGAAGAGAAAGAATCTACAGTGGTTTAGAGTGCAAAGAGAAAATTTATAGAAAGGGAC
TACGATTTAGGGTAATCAGATTAATAGTAGATGATCGATGAAAACATATCTCATACAGAA
AAAAAATTCATAACTTCTGAATGCAAGTAAGAGTATGAGGGTTAGGACTCTAAGAAAAGA
CTGAAGCCTTTACTTCCTTTTAAATCCTCTATCAAGTTTTCCTGTAAAAAAAACAACTCA
TTTTCAGCATTCAATCTTTACAGAGATAAAGAAATACATACAAACATTAGTAGGTTTCCT
TAGAATTTTAAAAAATAAGATCTAGATTATGATTGCTCATCAGAAGAAGAAAGGACGGAA
GATCAAATTATATTTATGTCTGAAGAAATAATTAAAGAAATGCATAATAATTAAAGTTAT
CAATACTAAGACGCAACTAAAAGCTACTTTAATAATTGA


>TTHERM_00289290(protein)
MLIMETPQFSAKDKNGQNSQSSFHQEILRAPKKNQTKKTLQIKKNIILTSDVAHELRKIN
FNDSPLMNQFILMHARVFQDSKTPQTPIKNYRETLHDNNLFEEKESTVVQSAKRKFIERD
YDLGQSDQQQMIDENISHTEKKFITSECKQEYEGQDSKKRLKPLLPFKSSIKFSCKKNNS
FSAFNLYRDKEIHTNISRFPQNFKKQDLDYDCSSEEERTEDQIIFMSEEIIKEMHNNQSY
QYQDATKSYFNN


>TTHERM_00289290(gene)
ATGCTTATTATGGAAACTCCTCAATTTTCAGCAAAAGATAAAAATGGATAAAATTCACAA
TCTAGTTTTCATTAAGAAATTCTTCGTGCTCCAAAGAAAAATTAAACTAAAAAGACGCTT
TAAATAAAAAAAAATATTATCTTGACATCAGATGTAGCTCATGAGCTCAGAAAAATTAAT
TTTAATGATTCTCCTTTGATGAATTAGTTTATTCTTATGCATGCTAGAGTATTTTAAGAT
AGTAAAACTCCTTAGACTCCCATTAAAAACTATAGAGAAACGCTTCATGGTGATTTATCA
TTAAATAACTTGATATATTTTACTAATTTATTTATTTATTTATTTTATAGATAATAATCT
GTTTGAAGAGAAAGAATCTACAGTGGTTTAGAGTGCAAAGAGAAAATTTATAGAAAGGGG
TAAGTTTTTTTTTATTCAAGCCTCTTTTTAGTTAATTTAAATTTTTAACATTAAAGACTA
CGATTTAGGGTAATCAGATTAATAGTAGATGATCGATGAAAACATATCTCATACAGAAAA
AAAATTCATAACTTCTGAATGCAAGTAAGAGTATGAGGGTTAGGACTCTAAGAAAAGACT
GAAGCCTTTACTTCCTTTTAAATCCTCTATCAAGTTTTCCTGTAAAAAAAACAACTCATT
TTCAGCATTCAATCTTTACAGAGATAAAGAAATACATACAAACATTAGTAGGTTTCCTTA
GAATTTTAAAAAATAAGTATTGCTTTTAAATGTATTTAGATATTGCTTATTTAAATGTAT
TTAATATATTAAAAGGATCTAGATTATGATTGCTCATCAGAAGAAGAAAGGACGGAAGAT
CAAATTATATTTATGTCTGAAGAAATAATTAAAGAAATGCATAATAATTAAAGTTATCAA
TACTAAGACGCAACTAAAAGCTACTTTAATAATTGA