Identifiers and Description

Gene Model Identifier

TTHERM_00711850

Standard Name

MELG1 (Meiotic nuclear ELonGation 1)

Aliases

PreTt16845 | 112.m00089

Description

Required for the elongation of the micronucleus during meiotic prophase

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 9.9%

TetraMine Data

TTHERM_00711850

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_14121.19.000941515806455e-45hypothetical protein (137 aa)

General Information

Paragraph NoGene NameParagraph Text
143MELG1Melg1 protein localizes to the micronucleus during meiotic prophase. In a deletion mutant, homologous chromosome pairing and bivalent formation are slightly reduced. The gene is incorrectly annotated in TGD. The large transcript encompasses predicted genes TTHERM_00711850 and TTHERM_00711858 (see FGD, gene_000000331).

Associated Literature

  1. Ref:33172984: Tian M, Agreiter C, Loidl J (2020) Spatial constraints on chromosomes are instrumental to meiotic pairing. Journal of cell science 133(22):

Sequences

>TTHERM_00711850(coding)
ATGTTGGAATATAACTTAAAGAAATATGGCCTATTTGAATTATCTTAAAATTTCAAATAA
GAATAAATATAAGAGCAATCTAGTACTCGACAAGTTTTAAGGAGTTTTAAGAAATTAGAA
TAAATACCGTCTTACTTACTTTCTGATTTTGCATTAAATTTAGATAAATAATGTATATCA
TAAGAACTGGTAGGGTTAATCAGAAAGAAGATGTCAACATACAGATTTTCCACTAAAAAA
TTGTCTTTGTCACTAAATATGATAGCGTACTCGACAACAACACTTCAAAACCTGTTTAAT
GCTTTAGCTTAAGCAGAAATGTGTAAATGCTTGCAATTATACTATTGTCACAATTAAGTC
ACAAGTGAAGTTTCGGAAATCATAGGAAGATTTATGCGTTATTATTTCTTTCTGGAAAGA
GTGGATCTAGATATAAGTTACTGTACTGATTTCTCCATTAAAGATGTTAATAATATAATA
TCCTCTATCAGGAAGACCTTAACTCACTTCTCAATTAATTTCAAAAGTGCAAACATTACT
GACATTTGTTTGAAACACATCTCAAAAACTATGGAGAGCTTCACTAAAATTTAATCTCTA
TTTATAGATTTATCTTAAAACTAGATAACTAAAGCTGGTGTAAGAGAGTTCTTTTATAGC
CTAAAACAAATGAATTATCTCAGAGAGCTGGGGCTAACGTATGGAGGTAATAACTTAGAA
TTAAAGGATGTGATGTTTGAAGTTAGAAACATGAAAAAACTGAAAAGCCTTTATCTGGGG
TTACAGATTCCCTCTTCTTCTAACAACTTGTTTTTTGATGATGAAGCCTTCGAAGAGAGT
TTTGACTATCATAGTCAGTTTATAGAATAAGAGAAAATCAGCTAATACTGTTTGATTAAA
AGCAGTGATTTAATTGATCTAAAATAATATGTGAAAGAATTAAATGAATTAACTAGCCTT
TCTTTAAACATACAAAACCAAAAATATGTGTCCCCTTATCTTAATTTATTGATATGTCCT
TATTTGTTTCATCTTAAAGAAGTTAGAATTTATACTCGGGGCTTTTCTATGTAGAACTAA
GATGCTCAGTAGCTATTTTACAATATGGCTCATATGGAAAATTTGATATCAATAACTTTA
AAATTAGAGGAGAATTCGTTGACGTCAGCTATTGGTGAATATTTGAATTATATGATTAAG
CGAAAGTATGAATAACTGATCAAGCTGGACGTATCGTTCAAATCAAATATTTTAGACGAA
TGTTGCATCAGTGATATATTTATGCCTTTATTTAAATGTGAGTACCTGACTGAATTCTCA
TTCACTATCTTTGATGGAGATAATTTCTTCTATGAAGAATAAAATTAAGATATCAGTATG
ACATTTTAGAGGCTATTATATTTCATTCAGTCATAGTGTATCATCAGATAATCTATTTTG
CTTTAAACACTAATATAAAATAAAGTTATGTAAATGAAATGA


>TTHERM_00711850(protein)
MLEYNLKKYGLFELSQNFKQEQIQEQSSTRQVLRSFKKLEQIPSYLLSDFALNLDKQCIS
QELVGLIRKKMSTYRFSTKKLSLSLNMIAYSTTTLQNLFNALAQAEMCKCLQLYYCHNQV
TSEVSEIIGRFMRYYFFLERVDLDISYCTDFSIKDVNNIISSIRKTLTHFSINFKSANIT
DICLKHISKTMESFTKIQSLFIDLSQNQITKAGVREFFYSLKQMNYLRELGLTYGGNNLE
LKDVMFEVRNMKKLKSLYLGLQIPSSSNNLFFDDEAFEESFDYHSQFIEQEKISQYCLIK
SSDLIDLKQYVKELNELTSLSLNIQNQKYVSPYLNLLICPYLFHLKEVRIYTRGFSMQNQ
DAQQLFYNMAHMENLISITLKLEENSLTSAIGEYLNYMIKRKYEQLIKLDVSFKSNILDE
CCISDIFMPLFKCEYLTEFSFTIFDGDNFFYEEQNQDISMTFQRLLYFIQSQCIIRQSIL
LQTLIQNKVMQMK


>TTHERM_00711850(gene)
ATGTTGGAATATAACTTAAAGAAATATGGCCTATTTGAATTATCTTAAAATTTCAAATAA
GAATAAATATAAGAGCAATCTAGTACTCGACAAGTTTTAAGGAGTTTTAAGAAATTAGAA
TAAATACCGTCTTACTTACTTTCTGATTTTGCATTAAATTTAGAGTAAAATATTCTTAAT
TATGGTCCATTATGTATTAATTAATTTATTTACTTATTTATTTGCTTGATTCATTCATAC
CTTCCTACTCTTTGATTTATAATTACTGGAAGGATTTTTTTATCAAATGTTCAAGCCAAT
TAACTCACTAATATACCTTTTATTTATTTAAATTATTGTAGTAAATAATGTATATCATAA
GAACTGGTAGGGTTAATCAGAAAGAAGATGTCAACATACAGATTTTCCACTAAAAAATTG
TCTTTGTCACTAAAGTAAAATTTTTATGGGTTTATCAAAAATATTAGAATTAAAAATAAA
TATGCTATAATTAAAATAAAATAAATTATTAATTCATAAATAGTATGATAGCGTACTCGA
CAACAACACTTCAAAACCTGTTTAATGCTTTAGCTTAAGCAGAAATGTGTAAATGCTTGC
AATTATACTATTGGTAATCTTGAAAAATACACTTTTTGAATAATTAATAATATCTATCTT
TGTTACTGAATATAAAGTCACAATTAAGTCACAAGTGAAGTTTCGGAAATCATAGGAAGA
TTTATGCGTTATTATTTCTTTCTGGAAAGAGTGGATCTAGATATAAGGTAGTAAAATATT
ACAATCATCTGAACAAATAAATTTTTAATTATATAGTAAACAAAGGAAATAATGAATTTA
ACATACTTAATTAGCATAACGCATTTAACATCAGGTATTTTTGATGTATCAATTAATGTG
AATAGTATTTCTGAAATTTATGTTACATTATTTACTTTTAATTATCACTCACACCTTACA
GATAAATTTAACATTTCACTATTTTATTCTACTCAATTTAAATTTTTTATTAGAGTAATG
GAATAAATTATTCATTTTCGTATGCATATTTAAATGCAAAACTAAGTAATAAGTAAATAG
ATAGATAGATATACTAGCTGTCAATTAAAATTGCTAAATTTAACATTTATTATAATAAAA
TAAAGTTACTGTACTGATTTCTCCATTAAAGATGTTAATAATATAATATCCTCTATCAGG
AAGACCTTAACTCACTTCTCAATTAATTTCAAGTAACTAATCATTAACAATCCATTATTT
TAATTATTGACTGGATTAATATATTATAACCACATAGAAGTGCAAACATTACTGACATTT
GTTTGAAACACATCTCAAAAACTATGGAGAGCTTCACTAAAATTTAATCTCTATTTATAG
ATTTATCGTAATTTACTTTTTATCCTTTTTTTTTTATAACTCAACATATTCCTAACTCAT
TGTATAAACAATTTAACTATTAAAACCATAATTGAAGCAACATTATCCATCCTCCATCTT
TCTGATATTTACTATTTTAACAATTTTTAATTATGAACTTAGTATTAAAAGATCAAATAA
TTTAATATTTACTACCATAAATTATCAAAAAATACATCTGATATTTTAAATATTAAGTTA
TCATTTTATAATCAATAAAAACTGATATTTTAATTATTATAAATAATTTCTGATATATGG
TTTATAGAAAAATACAGTATATGCATCATTAAATGGTATTTTTTAATAAAATATTCAAAA
AATATATTTTATGTAGTAATAATTATTTTATAAATCTCTAAACATATTATTGATATACCG
ATATAACTTGAATGCATTTTTAATTTAAATTGAATCAAAAAAAATAAACGATGATTACTT
TTTCATAATACATGTACAAATTTTGATTAACTGATTAAAATTTTAGCTATATTATTTAAT
TTCCTTAACTTACTTTTAGCCTCAATTGAAAAATTAATATAATAGTTAAAACTAGATAAC
TAAAGCTGGTGTAAGAGAGTTCTTTTATAGCCTAAAACAAATGAATTATCTCAGAGAGCT
GGGGCTAACGTATGGGTAAATTAATAACTTTTTATTATGTAATATATTTGATGGAATAAG
TAAAATTTAATATGTTAATTACTAGGTAGCTTGGAAGCTATTATTAAAAAAAATCTTAAA
TTTTAGTCAATTTTATTTTACATTTATGAAATCAATTCAAAAAAAATAGAGGTAATAACT
TAGAATTAAAGGATGTGATGTTTGAAGTTAGAAACATGAAAAAACTGAAAAGCCTTTATC
TGGGGTTACAGTAATTTGAATTAAATTATTTTTTTTCATACATTTTCAGATATAAATTAA
ACCAATAATTATCTTGAATTTTAATTTCTATTTTTAACTTTTTTAAATTCAAGCACTACA
CTTTCTATAACAAATAACAGCTATTATTTCTAAATTTACCAGAAAATGCATAAAATTAAC
TAAAGTTAACTATTTTAAAAACTTTTTTAAATTATAATAAAAGGATTCCCTCTTCTTCTA
ACAACTTGTTTTTTGATGATGAAGCCTTCGAAGAGAGTTTTGACTATCATAGTCAGTTTA
TAGAATAAGAGAAAATCAGCTAATACTGTTTGATTAAAAGCAGTGATTTAATTGATCTAA
AATAATATGTGAAAGAATTAAATGAATTAACTAGCCTTTCTTTAAACATACAAAAGTAAA
GATTATATTCCTATAAAAAATACACAAATTTTTAGATTTTAAGTAAGTAAAAGAATGCAA
TCAACTTGAGCTCTTCATTAATAAATAAATTTTAAGCATCTAAGTGAATTGAATACCCCT
TATTAAAACTTAAATCAGCCAAAACCAATTTTATTTTGTGTTTTTTTAAAAAAAATTTGG
CTTTTTTAAGAGAGAAAAATTGTTTGTTATTAACTATTTCAACTATTTATAATTATTTTA
TAATAAAAAGCCAAAAATATGTGTCCCCTTATCTTAATTTATTGATATGTCCTTATTTGT
TTCATCTTAAAGAAGTTAGAATTTATACTCGGGGGTAAGAAATATTAACTGAGTTTAAAA
TTTAAAGTATTTATACCTCTTATTATATAAAATAAGAATAATTGATTAGGATGGCAGCTT
AAAATTATAAATACCCAAACATTTATTATGATTAATTTACATAGATTTTTATTACTTTAA
ATAAATTTAAAAAGTATTTTTACTTTAAAATACAAAATTATTCCATGATAGAAAATAAAT
TAGATTGATAAAAATCAAAGATATAAATAGATATATTTTATATAATCAATAATCAATAGA
ATGGTTGAGATATTATAAAAACAAGTACATTTAATCTGAGAACTACTGTAAAATTTGTAT
ATTTACTAGTATTAAATCAAATAGATAATTAATTTAATAACTCCGCTTATTTGTTACAAT
ACCTTTTATCTATTACCCTCAATGCTTATTTAATTAATTTGCTAATTGAAAATAATTAAA
TGCTCTATCTAACCATAGAGAATATATCCTATAATAAATAATTCAAATAATCAATTCAAG
CATTAAAATAGAATATTAATATCAAAATAAAAAAGCCCTACCCTTCAATATGTTTTATGA
ACAAATAAAATCAATTATCAAAACATAAAATTCAAGCAATGTAATTTAGATACAAAAATA
ATAAATACTTTGGAATATTAAATTTCAATAAAGTCTCTGATTCATCTTTTAAAGAATAAT
TATTTTCTCTTTCCTTAAAATAATAACAAAACATTCATCCATTCAATATTATAATATTAT
GTATATTCTTCGATAGCTAAAGCTGTTAAAGAGTAAGCATAAAGCTCTAAATTTTGTTTA
TTTTACTAGAGATTTATGAAATCCATAAAATTTGAATTGGCTGGGCTAATCTTTCAATTA
GAATAGCTATATTTTTGAGCTAGTGTTTGGCCCATTGCAGTAACTTAATTTTTTAAATTA
AAAAAATCATTCAAGCTAATTTGGTTTAATTACACTCTCAAAAGAAGACTTTTAATTTAA
ATTGAGTATCAAAAATTAGGAATTAGAATGAGATAAAAGTCAAAAATCTATTAAATAATT
CAATAAATATTCTACTAAAATTTATTATATAATAGTAATTGGTTATTTTTTAAAAGTAAG
ACTTCAAATTGAAAGAATGTTTTACAGAATTCAAGCTTGCCAGTTTAAATTTTGATAAAA
TTACTTAATAATGCTTGTAAATTAATATAATAAATAATATTCCATTTAATATAACATAAA
AGCTTTTCTATGTAGAACTAAGATGCTCAGTAGCTATTTTACAATATGGCTCATATGGAA
AATTTGATATCAATAACTTTAAAATTAGAGTAATTAATAAATAACTTACTTTCTTACTAA
CAATCAAGATATGTTTTAAATGAGACAAGTTTTAAAACACAGCTATAAAATTTAATATCT
TATTTATTTTTTACTAAAATAAATAAAATAAAAAGGGAGAATTCGTTGACGTCAGCTATT
GGTGAATATTTGAATTATATGATTAAGCGAAAGTATGAATAACTGATCAAGCTGGACGTA
TCGTTCAAGTGTGTTTATTTATTTATTAAATTTGAATTTTCTTTTCTAAAATAATACATA
CTAAGTTCAAATATAGTAATCGAACAATTAATTAATTGATAGATTCAATCATTCTATCAC
TTATTAATAGATTTTTTTTATTTTTTGTTTTAGATAGTCATAGGTATTTTATTAATGCAT
ATACAAATATAAAAAATATTGAAAGATTTTAAAAGGATTATTGATAAATACTTATTAATA
TATTTATATTTTATTTAAAGATCAAATATTTTAGACGAATGTTGCATCAGTGATATATTT
ATGCCTTTATTTAAATGTGAGTACCTGACTGAATTCTCATTCACTATCTTTGATGGGTAA
ATTTTTTGCTTTTATTTTTCAGCAAAAACTTTAGGCAAGCCTTTTGAAAATAATTGAGCC
AGTCTTTTTCTATTAAAAAGATATATAAAGTTTATACTTAAATTATTGCTTTACAAGGAG
GATTTTTTTAATAATTTAATTCTGATATCTAAAAATATTATTAAAATATTCAATATTTTT
TATATCTAAATATAGAGATAATTTCTTCTATGAAGAATAAAATTAAGATATCAGTATGAC
ATTTTAGAGGCTATTATATTTCATTCAGTCATAGTGTATCATCAGATAATCTATTTTGCT
TTAAACACTAATATAAAATAAAGTTATGTAAATGAAATGA