Identifiers and Description

Gene Model Identifier

TTHERM_00147570

Standard Name

MED7 ( transcriptional mediator complex subunit 7)

Aliases

PreTt20615 | 12.m00289 | 3700.m00012

Description

transcriptional mediator

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00147570

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_04912.11.000157752625888e-137hypothetical protein (350 aa)

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:18515835: Bourbon HM (2008) Comparative genomics supports a deep evolutionary origin for the large, four-module transcriptional mediator complex. Nucleic acids research 36(12):3993-4008

Sequences

>TTHERM_00147570(coding)
ATGGCAGATGATATGTTCGATAATTTATCCAGTCCTAGCAAGGAAGATAATAATAATATG
TAGGAAATCGATGATGCATTTGGTGATAATATGATATAAGAAAATAATAATTTTGGATAA
GTATATGGCGAGCAAGAAGATTTTGATAAAAATTACTTTAATCCAAATTATTACAATAAT
TAATAAATGATTGATGAGTAACCTGAATAGCCGCCGTAATATTTGTATTAGTAAAGTAGT
ATAGGATTTCCAATTCGCCCTTTAAGTGTTATTGAATAAAATGAGCAATAAAATCAGCCA
AATTTAGAGATCAACAAAGTATAAGACCAATTGGAAGAAGAGTAAGCTGAAAATATAGAA
ATGAATCAGTAACAAGAATTATTGGAATTATGTAATGATCATTTATTAGTTAAAGATGAA
GAAGATGATAAAGAAATACAAATTAAATCTTAAAATGATATGAAACCAAATGATGAACCT
GAATTTTTTTAACAAGAATTTCAAGATATATATCAAGCAGCCTCTTAAGTTATTGATAGA
CAAGTATTTTGCTTTCCTCCTCCATACTTTAGAAATTTTATCACACCTAAATAAATGGCT
CCCCCAAGCTTGGAAGTTATTTAAAAAAATAAATAATACTTTTCACTTGGATATAAAATG
GATTTTTCTAGTGTATATTAGAAGCCTAACGAAACTATTTCAAGCGAAGAAAAGGCTGAT
ATAAGTACAGTTCTTACTCCTAACAAAAATTTATATGACGTGATGTAGGAAATTATGAGC
TCAATAATGAATAAATCGGTAGAAATTTTGAAACATTCACAATAAGGAGGATAATAATTA
AATGATTATATTTCTGAAATGGAATTATTAGTTAAAAAATTTGCTATTCTCTGCAAAATG
TCTAAGATAAAATTTGCTAAATTAGAAGTAATGAAAATATTTGAAAATGAAAAGGCTCTT
TTCTAAAAAAGTGCTGATTAAATAAATACATCGATTTCTTAAATCAAGAGATTTAAAGAA
TCTCTAAAGATAAATGAAATAATTAATTCAAAAAATCCTGTCATATGA


>TTHERM_00147570(protein)
MADDMFDNLSSPSKEDNNNMQEIDDAFGDNMIQENNNFGQVYGEQEDFDKNYFNPNYYNN
QQMIDEQPEQPPQYLYQQSSIGFPIRPLSVIEQNEQQNQPNLEINKVQDQLEEEQAENIE
MNQQQELLELCNDHLLVKDEEDDKEIQIKSQNDMKPNDEPEFFQQEFQDIYQAASQVIDR
QVFCFPPPYFRNFITPKQMAPPSLEVIQKNKQYFSLGYKMDFSSVYQKPNETISSEEKAD
ISTVLTPNKNLYDVMQEIMSSIMNKSVEILKHSQQGGQQLNDYISEMELLVKKFAILCKM
SKIKFAKLEVMKIFENEKALFQKSADQINTSISQIKRFKESLKINEIINSKNPVI


>TTHERM_00147570(gene)
TTCATTAAAAAAAGATATAATAAAATTATTAATCTATTGATTAATTAATTATAATATCTT
TATAAATAGCTTGGCTAGATAGCTCATAAAAAGCAAAAATAGCTTCTATTTGATTAGAAT
AATAACAAATTTAAAGTTTAGTTAAGGCATTAATATAAAATGGCAGATGATATGTTCGAT
AATTTATCCAGTCCTAGCAAGGAAGATAATAATAATATGTAGGAAATCGATGATGCATTT
GGTGATAATATGATATAAGAAAATAATAATTTTGGATAAGTATATGGCGAGCAAGAAGAT
TTTGATAAAAATTACTTTAATCCAAATTATTACAATAATTAATAAATGATTGATGAGTAA
CCTGAATAGCCGCCGTAATATTTGTATTAGTAAAGTAGTATAGGATTTCCAATTCGCCCT
TTAAGTGTTATTGAATAAAATGAGCAATAAAATCAGCCAAATTTAGAGATCAACAAAGTA
TAAGACCAATTGGAAGAAGAGTAAGCTGAAAATATAGAAATGAATCAGTAACAAGAATTA
TTGGAATTATGTAATGATCATTTATTAGTTAAAGATGAAGAAGATGATAAAGAAATACAA
ATTAAATCTTAAAATGATATGAAACCAAATGATGAACCTGAATTTTTTTAACAAGAATTT
CAAGATATATATCAAGCAGCCTCTTAAGTTATTGATAGACAAGTATTTTGCTTTCCTCCT
CCATACTTTAGAAATTTTATCACACCTAAATAAATGGCTCCCCCAAGCTTGGAAGTTATT
TAAAAAAATAAATAATACTTTTCACTTGGATATAAAATGGATGTAACTAATAAATTAAAC
TTTGATAGACAAATAATTTTTCTTTATACATATAATTTAAATAGTTTTCTAGTGTATATT
AGAAGCCTAACGAAACTATTTCAAGCGAAGAAAAGGCTGATATAAGTACAGTTCTTACTC
CTAACAAAAGTAGTTTACATTTTTGATTGTTTAAATTTGACGTGATTGTTTAATAAAAAG
ATTTATATGACGTGATGTAGGAAATTATGAGCTCAATAATGAATAAATCGGTAGAAATTT
TGAAACATTCACAATAAGGAGGATAATAATTAAATGATTATATTTCTGAAATGGAATTAT
TAGTTAAAAAATTTGCTATTCTCTGCAAAATGTCTAAGATAAAATTTGTAAATAATTTTA
ATAAATTAAATAATATTTTAATTAATTATTTATTTGATTTTTCTAAATATTTAGGCTAAA
TTAGAAGTAATGAAAATATTTGAAAATGAAAAGGCTCTTTTCTAAAAAAGTGCTGATTAA
ATAAATACATCGATTTCTTAAATCAAGAGATTTAAAGAATCTCTAAAGATAAATGAAATA
ATTAATTCAAAAAATCCTGTCATATGA