Identifiers and Description

Gene Model Identifier

TTHERM_00575570

Standard Name

MED6 (transcriptional mediator complex subunit 6)

Aliases

PreTt28947 | 77.m00159 | 3812.m02640

Description

transcriptional mediator

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 13.3%

TetraMine Data

TTHERM_00575570

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

No Data fetched for Homologs

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:18515835: Bourbon HM (2008) Comparative genomics supports a deep evolutionary origin for the large, four-module transcriptional mediator complex. Nucleic acids research 36(12):3993-4008

Sequences

>TTHERM_00575570(coding)
ATGTTCAGGATTGGAATATAAGTTTTTCTAAAATGCAAGATCAATCCACCAGAATCATGG
CAAAAGATATTCTTTTTGTTAAACGATTTGTATAGTGTTCGTTACTGCACTAAGAATAAT
CTAACCATCTCTGGTCCTTATCATACGCTGAGGTATGTAAGAAATCCCCTTAAAAGTTTT
TAAACTCGAATAATCTAATAAGAAATCAATCTACAAAATCTTAGCCACCATAGCTAAATC
TACCTTGTTTCAAGGATTTTCAGAACAACTCAGATATGTTTCTTGAAAATGATTTACTAT
ATCGCCCTTTACTCTATTTTTGAAACACCTGAATCTGCGGAAGCCTTAGCCGATTGCTAC
TGGAGAAGAAAATAGGGTGAGTCATTGGATTAAACAGTTTTAGGAGTATACTAGTAATCG
AGCCTTGGCCTAGGATCTTACTGGCGAAAAATAGATATTTTCTCGAGGAATCATCTATCT
CCTACAACTTCCTTTAACTCCAACACCCTATTTTAATTTAAATTGGAATATCAAAAAAAC
CCAAAAACCCAGGTTAAGGTATAATGA


>TTHERM_00575570(protein)
MFRIGIQVFLKCKINPPESWQKIFFLLNDLYSVRYCTKNNLTISGPYHTLRYVRNPLKSF
QTRIIQQEINLQNLSHHSQIYLVSRIFRTTQICFLKMIYYIALYSIFETPESAEALADCY
WRRKQGESLDQTVLGVYQQSSLGLGSYWRKIDIFSRNHLSPTTSFNSNTLFQFKLEYQKN
PKTQVKVQ


>TTHERM_00575570(gene)
ATGTTCAGGATTGGAATATAAGTTTTTCTAAAATGCAAGATCAATCCACCAGAATCATGG
CAAAAGATATTCTTTTTGTTAAACGATTTGTATAGTGTTCGTTACTGCACTAAGAATAAT
CTAACCATCTCTGGTCCTTATCATACGCTGAGGTATGTAAGAAATCCCCTTAAAAGTTTT
TAAACTCGAATAATCTAATAAGAAATCAATCTACAAAATCTTAGCCACCATAGCTAAATC
TACCTTGTTTCAAGGATTTTCAGAACAACTCAGATATGTTTCTTGAAAATGATTTACTAT
ATCGCCCTTTACTCTATTTTTGAAACACCTGAATCTGCGGAAGCCTTAGCCGATTGCTAC
TGGAGAAGAAAATAGGGTGAGTCATTGGATTAAACAGTTTTAGGAGTATACTAGTAATCG
AGCCTTGGCCTAGGATCTTACTGGCGAAAAATAGATATTTTCTCGAGGAATCATCTATCT
CCTACAACTTCCTTTAACTCCAACACCCTATTTTAATTTAAATTGGAATATCAAAAAAAC
CCAAAAACCCAGGTTAAGGTATAATGA