Identifiers and Description

Gene Model Identifier

TTHERM_00691210

Standard Name

MED4 (mediator)

Aliases

PreTt02959 | 106.m00099 | 3674.m00012

Description

transcriptional mediator

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 9.9%

TetraMine Data

TTHERM_00691210

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_17616.13.000551941601253e-121hypothetical protein (239 aa)

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00691210(coding)
ATGATTAATGAAAGAAGTTTAAACGATTTTATAGAAAGGTACTAAAAGTTAAAAGATCTA
AAAGGAGAAGAGGAAGCAGATGATATTTTTGAAAACAAAATAGAAAACTTGAAAAGATAT
TTGCTAGAATCATAAGATCTTTTATAATAAACCGTCAACACTGTAGAAGGCAATACTTAA
GCAGCCAGCTTATCTAATTCTACAAGTGATGAAATAGTTAACTATGCATTAAGAAACGAA
AGCCACTACTATTGTCCTCATGTTGAGGAAGTTTTAAGTTCTTATCTATTTAAAATAAAT
TCTCGCACATATTAGAAAGCATAGGAGCCAAAAGTTTAATCAGGAGGTTTGCCATATGCA
AATTAAGATAAAGTCATAGAAATAGAAATGTACAAACAAGTGAACAAAGATTTAAAAATT
TAACCCTGTGGAGATGAAGGTATTTATGCTACTATTGACAAATAAATGCCAAATATATGT
ATTCATGAAAAAAGAGAAATGTTTTCTGAAAATTTTTCAAACAGAGTAGGAACAAAGTAA
GAAGTTAGATTCTTAGCTTTTAAACCAGGTATGCTAGAAAGCGAGCTTGGTGTTGCATAT
TTAGATTTGACAAATACTGGAAATATTAATAAAGCTGGTGAGCAAAGTGGTATGGTTGTA
GAATCTCTGTCTGTTTAACATAATATAGTAGCTTCAAGTTCAGTAGATTGGGGATATTAG
TGA


>TTHERM_00691210(protein)
MINERSLNDFIERYQKLKDLKGEEEADDIFENKIENLKRYLLESQDLLQQTVNTVEGNTQ
AASLSNSTSDEIVNYALRNESHYYCPHVEEVLSSYLFKINSRTYQKAQEPKVQSGGLPYA
NQDKVIEIEMYKQVNKDLKIQPCGDEGIYATIDKQMPNICIHEKREMFSENFSNRVGTKQ
EVRFLAFKPGMLESELGVAYLDLTNTGNINKAGEQSGMVVESLSVQHNIVASSSVDWGYQ


>TTHERM_00691210(gene)
ATGATTAATGAAAGAAGTTTAAACGATTTTATAGAAAGGTACTAAAAGTTAAAAGATCTA
AAAGGAGTAATAAATAATCATTTATTTTTATTTGAGAAATAGTTTGTAAAAATATTTTTT
ATTCTAACTATTTGACTAACGAAAAGGAAGAGGAAGCAGATGATATTTTTGAAAACAAAA
TAGAAAACTTGAAAAGATATTTGCTAGAATCATAAGATCTTTTATAATAAACCGTCAACA
CTGTAGAAGGCAATACTTAAGCAGCCAGGTAATATTTGATTAATAATAATAAAAATAATA
TTATTTCATATGTTTTTGTTACATAAATAATTTTCATTTTATATTTTTTTTGTTTGTAAT
ATCTAGCTTATCTAATTCTACAAGTGATGAAATAGTTAACTATGCATTAAGAAACGAAAG
CCACTACTATTGTCCTCATGTTGAGGAAGTTTTAAGTTCTTATCTATTTAAAATAAATTC
TCGCACATGTAATATTTTTGTACATGAAATGGATAATAAAATTAAAATTTACATCTATTT
ATTTTAAAATCTAAGAAAATGTTAAGTAAAATATTTGTTTTTGTATATATAGATTAGAAA
GCATAGGAGCCAAAAGTTTAATCAGGAGGTTTGCCATATGCAAATTAAGATAAAGTCATA
GAAATAGAAATGTACAAACAAGTGAACAAAGATTTAAAAATTTAACCCTGTGGAGATGAA
GGTATTTATGCTACTATTGACAAATAAATGCCAAATATATGTATTCATGAAGTAAATTTG
TTTTGGAAAAAAAAAAATTTCAAATTTAAATAAAATAAATTTATCTAGAAAAGAGAAATG
TTTTCTGAAAATTTTTCAAACAGAGTAGGAACAAAGTAAGAAGTTAGATTCTTAGCTTTT
AAACCAGGTATGCTAGAAAGCGAGCTTGGTGTTGCATATTTAGATTTGACAAATACTGGA
AATATTAATAAAGCTGGTGAGCAAAGTGGTATGGTTGTAGAATCTCTGTCTGTTTAACAT
AATATAGTAGCTTCAAGTTCAGTAGATTGGGGATATTAGTGA