Identifiers and Description

Gene Model Identifier

TTHERM_00355460

Standard Name

MED31 (mediator )

Aliases

PreTt27532 | 37.m00249 | 3836.m02338 | SOH1

Description

Putative Subunit of the RNA polymerase II mediator complex; conserved with other metazoan MED31 subunits

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

  • RNA polymerase II transcription mediator activity (IEA) | GO:0016455

Biological Process

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.3%

TetraMine Data

TTHERM_00355460

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_02286.16.002203762674495e-72hypothetical protein (151 aa)
DictyBaseDDB_G02852210.000000000000001999258566166494med31 on chromosome: 4 positio
n 2996613 to 2997218
WormBaseWBGene000070260.00000000000004998767099442072locus:mdt-31 status:Confirme
d UniProt:I2HAC1 protein_i
d:CCH63828.1
SGDYGL127C0.00000019998969434520019SOH1 Subunit of the RNA polyme
rase II mediator complex; asso
ciates with core polymerase su
bunits to form the RNA polymer
ase II holoenzyme; involved in
telomere maintenance; conserv
ed with other metazoan MED31 s
ubunits

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:18515835: Bourbon HM (2008) Comparative genomics supports a deep evolutionary origin for the large, four-module transcriptional mediator complex. Nucleic acids research 36(12):3993-4008

Sequences

>TTHERM_00355460(coding)
ATGATGTAGCATTAAATGAGCATGCAAATTCAAAGCTAAAATCAATAAGATTAAAGCTAA
CAAGCCAACCAAGATCTTATGAATTTTAGGTCTGATTTTGAATAATACTAAAGATTTTAG
TTAGATCTTGAATTTGTCAATATGCTAGCCAATCCATATTACATTTTATAACTTTAAGAA
TATGATTATTTTTCAAACGAAAGATTTTAAAATTATTTGAAGTATTTATCATATTTCAAA
CAACCTGAATATTTCAAATTCGTTAAGTATCCACTAGGCATAAAAATGCTTGATTTAATT
TAACAAGACAAATTTATTGAAAACTTGAGTAATAACGGAATTGAATTAGCAAATAAAATG
AATATTCAAAATACTTATACTAAATAATTTTTAAATTATTTAGCAAAAAAATCTAGCTTG
TAAAAAGATATTAAAAAAGAAGAAAATTGA


>TTHERM_00355460(protein)
MMQHQMSMQIQSQNQQDQSQQANQDLMNFRSDFEQYQRFQLDLEFVNMLANPYYILQLQE
YDYFSNERFQNYLKYLSYFKQPEYFKFVKYPLGIKMLDLIQQDKFIENLSNNGIELANKM
NIQNTYTKQFLNYLAKKSSLQKDIKKEEN


>TTHERM_00355460(gene)
AAAATAAATAAATCAATTATATTTGCGAATTATAAATAGTCTAATTAGTGTTTAATATTT
TGCAAAATAAGAAAAAAAGATTTACTTACTAAAAAAATATCTTTAAAGCAAGCTAAATTT
TGGGTATTCTAATATAAAATGATGTAGCATTAAATGAGCATGCAAATTCAAAGCTAAAAT
CAATAAGATTAAAGCTAACAAGCCAACCAAGATCTTATGAATTTTAGGTCTGATTTTGAA
TAATACTAAAGATTTTAGTTAGATCTTGAATTTGTCAATATGCTAGCCAATCCATATTAC
ATTTTATGTATAATTAAATATTACATTTTAGACAAATAAAATATTTAGATTTTTTTAAAT
AGAACTTTAAGAATATGATTATTTTTCAAACGAAAGATTTTAAAATTATTTGAAGTATTT
ATCATATTTCAAACAACCTGAATATTTCAAATTCGTTAAGTAAGCTTTACTATTTAATAC
AAATCATTTCTAAGCAATTTTTTAAAAAAAGGTATCCACTAGGCATAAAAATGCTTGATT
TAATTTAACAAGACAAATTTATTGAAAACTTGAGTAATAACGGAATTGAATTAGCAAATA
AAATGAATATTCAAAATACTTATACTAAATAATTTTTAAATTATTTAGCAAAAAAATCTA
GCTTGTAAAAAGATATTAAAAAAGAAGAAAATTGA