Identifiers and Description

Gene Model Identifier

TTHERM_00490630

Standard Name

MED3 (mediator)

Aliases

PreTt08368 | 60.m00165

Description

transcriptional mediator

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00490630

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_13533.12.0004037638327014e-151hypothetical protein (298 aa)

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:18515835: Bourbon HM (2008) Comparative genomics supports a deep evolutionary origin for the large, four-module transcriptional mediator complex. Nucleic acids research 36(12):3993-4008

Sequences

>TTHERM_00490630(coding)
ATGAATAAGAATAAGCAAAAATATTTAGTGAAGATAGACCATAATATAAATCTATTATCA
GCAGTAAAAAAGAATTTGATCAATTACTTAGAAGCGATAAAGAATTTACAATCAACCATA
AATAATCCTTAGCTTCCACCCAATTAAAGATAAACTCCTCAGAATGTTGATAAGAAAAAG
ACTAATTTAGAGAAGTCCTTGGAAATGTTTTTGGCAAATTATAAAGAAGTGGAGGACTAA
AAAAATTTCGAAAAGAACTAATAGATTAAGGATGGATTTGAAGAGGTGATAATACAAAAT
CAATATTTCTAGCTTGAAAAGAAACTTAACACTAAGGATATTTAGTATTTTAAAAGAATT
GAGTCAAGTATAGGAATTCTTATTGAGCCAGGAATGATTTCAATACGCAGACCTAATTTA
CCTGGTCAGCCTCTTTCTAATTATTAAATAGTCATTTTTGTGCGCGAAGCAAAATTCCAT
ATGTAAAATAACACTTACTAAACTATATATATTGTATAAGATCTTATTGTTTGCCCAATC
CCTAAGAGATTACAAAGCTAATAGTCTAACTAAAGCATTCTTAGTAATGAACCAGAAAAA
ATTGAAATCCCAGATAAAATCCCTGAAGTATTCAAAGAAATATCTGTGTTTGTTAGAATA
GCTTAGAAAAAATTAGATACAAATGTATTATTCGACATGTTCTTCCCATAAATGAAAACT
AATAAAATTGATTACTTCTCAAAAGTATTTTAATCTTCAACTCTTTGTGACTACTGCAAA
AATTACATGAAACTTAAATCCCCTAAAGAAGGATTTATTCCTCCTACTATTCAATATAAT
AATAAATTCTATCATACATAATGCTTTAAAGAGAAAGAATTTTATTGA


>TTHERM_00490630(protein)
MNKNKQKYLVKIDHNINLLSAVKKNLINYLEAIKNLQSTINNPQLPPNQRQTPQNVDKKK
TNLEKSLEMFLANYKEVEDQKNFEKNQQIKDGFEEVIIQNQYFQLEKKLNTKDIQYFKRI
ESSIGILIEPGMISIRRPNLPGQPLSNYQIVIFVREAKFHMQNNTYQTIYIVQDLIVCPI
PKRLQSQQSNQSILSNEPEKIEIPDKIPEVFKEISVFVRIAQKKLDTNVLFDMFFPQMKT
NKIDYFSKVFQSSTLCDYCKNYMKLKSPKEGFIPPTIQYNNKFYHTQCFKEKEFY


>TTHERM_00490630(gene)
ATGAATAAGAATAAGCAAAAATATTTAGTGAAGATAGACCATAATATAAATCTATTATCA
GCAGTAAAAAAGAATTTGATCAATTACTTAGAAGCGATAAAGAATTTACAATCAACCATA
AATAATCCTTAGCTTCCACCCAATTAAAGATAAACTCCTCAGTAAAAAATAGAATCATGA
TAAATATATACATTTATAATAAAAAATAACTAAATGATTGATTGATAGAAATGATTAAAA
AATTTAAATTAACTTTCAATTTAATTAAATAAAATTCAAGGAATGTTGATAAGAAAAAGA
CTAATTTAGAGAAGTCCTTGGAAATGTTTTTGGCAAATTATAAAGAAGTGGAGGACTAAA
AAAATTTCGAAAAGAACTAATAGATTAAGGATGGATTTGAAGAGGTGATAATACAAAATC
AATATTTCTAGCTTGAAAAGAAACTTAACACTAAGGATATTTAGTATTTTAAAAGAATTG
AGTCAAGTATAGGAATTCTTATTGAGCCAGGAATGATTTCAATACGCAGACCTAATTTAC
CTGGTCAGCCTCTTTCTAATTATTAAATAGTCATTTTTGTGCGCGAAGCAAAATTCCATA
TGTAAAATAACACTTACTAAACTATATATATTGTATAAGATCTTATTGTTTGCCCAATCC
CTAAGAGATTACAAAGCTAATAGTCTAACTAAAGCATTCTTAGTAATGAACCAGAAAAAA
TTGAAATCCCAGATAAAATCCCTGAAGTATTCAAAGAAATATCTGTGTTTGTTAGAATAG
CTTAGAAAAAATTAGATACAAATGTATTATTCGACATGTTCTTCCCATAAATGAAAACTA
ATAAAATTGATTACTTCTCAAAAGTATTTTAATCTTCAACTCTTTGTGACTACTGCAAAA
ATTACATGAAACTTAAATCCCCTAAAGAAGGATTTATTCCTCCTACTATTCAATATAATA
ATAAATTCTATCATACATAATGCTTTAAAGAGAAAGAATTTTATTGA