Identifiers and Description

Gene Model Identifier

TTHERM_00670380

Standard Name

MED22 (mediator)

Aliases

PreTt01062 | 100.m00123 | 3731.m00033

Description

transcriptional mediator

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( TIGR01442 ) small, acid-soluble spore protein, gamma-type

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00670380

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_16452.12.9987670792171964e-67hypothetical protein (267 aa)

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:18515835: Bourbon HM (2008) Comparative genomics supports a deep evolutionary origin for the large, four-module transcriptional mediator complex. Nucleic acids research 36(12):3993-4008

Sequences

>TTHERM_00670380(coding)
ATGAACCCTGAAAGCAAATATATTGAATTTAAAACTAAGAAAGATGATTTAATGAAATAA
TATACTGAAACTTTTGTAAGCATTGCAGAATAGTTGAAAATTTCTGATAATCCATATGAA
GAATAATCTAAGCAAAACATTTTAAGAAAAGATGTATTAGAGTTTTTGAAGGTATCTTAG
TAATTGTTAAATTTAAGCAACGATATTAAAAAGCATGTTATTTTAAACGATGATATTTAT
TAAACAAACGATGAATTTAAGCTCTCTGAGAAAGATCTTTTAGAAAGAAAGTAAAATCTT
AGATATTCGTATGAAAATAAGTAAAAAGAAATGGAAATACAAATAAAAGAGAGATAGTAA
AGAGTTCATCAATAAAATTAGGCTAGCCATCCAAATTAACCTTATGCTCCTAGCGGTAAT
CCTCAAATATAAGGCTAAGGTAATCATCCAAATGTCTAATATTAAAGATAAATGTAAACA
GTTCCTGGCGGTCCTCATATAGTAAATCCTAATTAATAATAAAACATGTAAAGCTAATAG
TAATAATAGTATTATTAGCAATAATAAAATCCTTAAAATTAATGA


>TTHERM_00670380(protein)
MNPESKYIEFKTKKDDLMKQYTETFVSIAEQLKISDNPYEEQSKQNILRKDVLEFLKVSQ
QLLNLSNDIKKHVILNDDIYQTNDEFKLSEKDLLERKQNLRYSYENKQKEMEIQIKERQQ
RVHQQNQASHPNQPYAPSGNPQIQGQGNHPNVQYQRQMQTVPGGPHIVNPNQQQNMQSQQ
QQQYYQQQQNPQNQ


>TTHERM_00670380(gene)
ACTACAGATATTAATTATTTATTTATTACATTATTCCAAATTGTTTTTTAAAATTAAGAT
ACACAACACAAATATTTTTTTAGTAAAAAAATAAACTTTTTTAGTTTAGCTAAATAGATA
GACTTCATAATAAAAAGAAAAATGAACCCTGAAAGCAAATATATTGAATTTAAAACTAAG
AAAGATGATTTAATGAAATAATATACTGAAACTTTTGTAAGCATTGCAGAATAGTTGAAA
GTAATTAATTTAATATTAATAATAGTTATTGCTAAATTAAAGTAGAATATTTGACAATTT
AATATTTTAATAAGTTTTAAATATAAATTTATGATAGATTTCTGATAATCCATATGAAGA
ATAATCTAAGCAAAACATTTTAAGAAAAGATGTATTAGAGTTTTTGAAGGTATCTTAGTA
ATTGTTAAATTTAAGCAACGATATTAAAAAGCATGGTAATTAATTAATATTAGCTTTAGA
ATATGGCTTTGTTAAAATATTTTATTTAATATTACTTAATCTAGTTATTTTAAACGATGA
TATTTATTAAACAAACGATGAATTTAAGCTCTCTGAGAAAGATCTTTTAGAAAGAAAGTA
AAATCTTAGATATTCGTATGAAAATAAGTAAAAAGAAATGGAAATACAAATAAAAGAGAG
ATAGTAAAGAGTTCATCAATAAAATTAGGCTAGCCATCCAAATTAACCTTATGCTCCTAG
CGGTAATCCTCAAATATAAGGCTAAGGTAATCATCCAAATGTCTAATATTAAAGATAAAT
GTAAACAGTTCCTGGCGGTCCTCATATAGTAAATCCTAATTAATAATAAAACATGTAAAG
CTAATAGTAATAATAGTATTATTAGCAATAATAAAATCCTTAAAATTAATGA