Identifiers and Description

Gene Model Identifier

TTHERM_00295380

Standard Name

MED21 (mediator)

Aliases

PreTt15648 | 27.m00308 | 3692.m00111

Description

transcriptional mediator

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00295380

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_08804.15.00115835552873e-49hypothetical protein (119 aa)

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00295380(coding)
ATGAATTAGGTTGTTTAATTAGAATAAACTATGAAGACATTTTTAAGAGACTTTTAGAAT
GCATTTAATCTAGTTCAAAACCCTCCCTAAGATTTAGATATGAATTATGTTGAAAATTAA
GCACGCTTTCTTTCATAATTAGCATAAGAAATGCAAAATGATATTAACAATCTTAAGCAA
ATTGATACATACACAGAAGAAGAGATAGAATAAAAAACTGAAAAATTATAGCAAGAAAGA
AAAATTGCTTTATAGCACTACTTAAGCTCTAAGGATGAAGCAGATAAATTAAATGAAAAC
TTGAAAGCAAATATAGATAACTTAGCTAATAAATTATACAGTCTAAATGAATGA


>TTHERM_00295380(protein)
MNQVVQLEQTMKTFLRDFQNAFNLVQNPPQDLDMNYVENQARFLSQLAQEMQNDINNLKQ
IDTYTEEEIEQKTEKLQQERKIALQHYLSSKDEADKLNENLKANIDNLANKLYSLNE


>TTHERM_00295380(gene)
AACAAAAGCGGCTAAAATATTGTAGCAAGCAATATATTTAATTTATTTAGAACGATTTAC
GAAAGATATAGCTAATTTAGTATTTATTTTCATAGATTTTGCTAAAATGAATTAGGTTGT
TTAATTAGAATAAACTATGAAGACATTTTTAAGAGACTTTTAGAATGCATTTAATCTAGT
TCAAAACCCTCCCTAAGATTTAGATATGAATTATGTTGAAAATTAAGCACGCTTTCTTTC
ATAATTAGCATAAGAAATGCAAAATGATATTAACAATCTTAAGCAAATTGATACATACAC
AGAAGAAGAGATAGAATAAAAAACTGAAAAATTATAGCAAGAAAGAAAAATTGCTTTATA
GCACTACTTAAGCTCTAAGGATGAAGCAGGTATGTTTATAAATTCAAGTAAATTTAAAAT
TATTTAAATATTTTTCATTTTATAAAATAAGATAAATTAAATGAAAACTTGAAAGCAAAT
ATAGATAACTTAGCTAATAAATTATACAGTCTAAATGAATGAGTCACTAAAAATAATCAC
TTTTTAATTCTAGTTATTAATCCTTTAAAAATATTTATTTTTTAGAATGTTGAGTATAGA
GTATTATTAAAAATTATATACATTTCGCTTTTTAAAAATAAATGAATTAGCTTTTTTAAA
GTATTGCTTACTGAAGATTGCACTAAAAATATTTACTAAACTTAATGAAGAAATATTTGC
TTATTTTAAATAATACAAATCAATTTAATTTTTATCTTTAAAAGCATCTAATAAATAATA
TGAACAAGCT