Identifiers and Description

Gene Model Identifier

TTHERM_00922930

Standard Name

MED20 (mediator)

Aliases

PreTt21172 | 164.m00065

Description

transcriptional mediator

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( TIGR01145 ) ATP synthase F1, delta subunit
  • ( PF08612 ) TATA-binding related factor (TRF)
  • ( PF05316 ) Mitochondrial ribosomal protein (VAR1)

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00922930

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_13262.19.997093137033517e-262hypothetical protein (992 aa)
OxytrichaContig11817.0.g650.000000100009565553302hypothetical protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00922930(coding)
ATGTTTAGTTCACTCCAATTTAAAATAGGTAATCTGCTTAAAGCAATTGGCACTTAAAAA
TAGATTTATAGGTTTGCTAGAGCTACTTAAGGAAAAATAAAGATTTAGAAAGAAAAATTG
GCAGATAAAATTGTTATTGAGAAATAGAAGGAAGCTAGAGAGAATTATATCGAAGAAAAG
AATGAGTTTTCTGCTGAAAACAATATAGCTTAAAATTATATTTTGAATTCAAAAAATCAT
GATAGATTATTTGAAGTATATGAGCATTTTAAAGATTAGATGAATATTATAAATTACTCA
ACTTGTCTCCATTAAGCGATTAAGTTACAAGAAAGTAAAGATTATAGCAATCTCTTAGAT
AAGTATGGACCATAAATTAAAGAAATATGTAATTAATTGGAAACTAATTTATAAAATATG
AAAGGATTCACTGCATCAAATTATTTGTCAAACTTAGTTAAGTTAAAATTATGCACTCCT
CATATTGTAGAAAGTATTTCTAATTTAATTGTAGAAAATAAATGGTAATTTAGTACAAAA
TAGACTTCATTTATACTCTGGTCTATGGCTCACTCAAACATAAAAAACGATAGATATCTT
AAATATGCAGCAACAAATTTAATGGCTATTAAAAGTACAATTGATCCTGAAGATTTAGCA
AATATTTTTTGGAGTTTAGGAAAGCTAAAATATATGAATGAAGATTTAACTATATACCTT
GAAGCTTAAATTTACAGAAATTCACAAAAGTTTCCAATTAACTGCATTAACATTGTCTTC
ACAAGTTATGAGAAATTTTATAGAAAAAATCTTGAAGTTTTAGATGCTTTATCAGGTAGA
TATATGGACTTAGGAAAGCATTTAACATATAGAAATTTATCAAACTTACTTGTAAGTTGC
AGTAACATGAACTATATTAACAGCATTTTGTTAGAATACATTGAGAAATAGCTCTTGAGA
AGAATTAAGGCTAGTATTGTTGAAGAAAATTCTGATGCTTTTGAAGATACAGGATCTTCT
ATTTTAGATAAGTATGCATAATAGTCAAATACCTACTCTCATGAAGAGATGGAATTATTT
AACAGTATAATAAAACTAAACAAACCAATTGAAGGTAATGAATAAGAAAGTTTAGTAAAC
GAATAATAAAAAAATCATAAAGAAGAAAATGAAGCTTCTGAAAAATTAGATAAAGATTTT
GAGGACGAAGATAATATCGATGAGCAAGAAGATGGATTTGAAGTTTTAGAAATTTCAACT
GATTAAAAAGCTATTTAACAGTTTTAAAAAGAATTCGAAGAGTAAAAATCTTATTTAGAA
GTAAAAAAGAAAGAAAATTCTGAAATAATTGAAAATTACCGAATTAAATAGCACAAATAT
GATAAAGTAGATGAGTTAGATCCAAAAAATGCTACTATGATTCTCTTAGCTTACTGTAAA
ATGAAAGTAGTAAAACCTGAATTATTTGAGGTACTAGAAGCTAATTTTTCAAATAAGCTT
GACTAAGCTACTCCTAAAGATGTGGCAACATATAGTTATGCCCATTCTATGCTATGCAAC
GAGCTATTAAGTTAGTTCCATGAATCTAAAAAGAGATATTTAAAAAGATCGTTAAATAAC
ATAAAAAAATATAATCATTACTTCTATGAAATTGTTCTTCCATTTGTAGAATTGAATCTT
GATAAGTACAACTGCAAACAACTTCAAGTAATTTTTTCTAGTGCAAGCAAACCTTAGGTG
AAAAAGAGAGCTATTTGCAGATAAATAGTATCTATTGGACTAAAATCTATCCCTAAATTG
AATGATGAAAAATTCAGCACAGAAGAAGAAAAAAATGTATTTATATATAAGCATTTCAAG
CTTATAACAAACTTTGCATATTCAGAAGATCATAGAAGATAACTCATTTTGGCTTGCTAT
GATAATGGCATTAAAATTGATGATATTTATAGAAGATACGCTCATATTCTCGTTAACAAT
AATATTCAAAATATATCTAATTAAGAATAAACTGATATACCTTTAGAATTAGAACCAAAA
TAATAATCAAGCTGGTTATTATAATAATAAGATAAAAGCTAAACAAGCTCAGATGAATCA
GTTTCTGTGTCAGAGCAGGACAGCTTATCTGAGAATGAAGAAGAAGAACAATAATAAAGT
AGTAATTTATAAAAAGATAATCAAAAATTTACAATAAAGAGCGTTTTTGATAAAAACTGA


>TTHERM_00922930(protein)
MFSSLQFKIGNLLKAIGTQKQIYRFARATQGKIKIQKEKLADKIVIEKQKEARENYIEEK
NEFSAENNIAQNYILNSKNHDRLFEVYEHFKDQMNIINYSTCLHQAIKLQESKDYSNLLD
KYGPQIKEICNQLETNLQNMKGFTASNYLSNLVKLKLCTPHIVESISNLIVENKWQFSTK
QTSFILWSMAHSNIKNDRYLKYAATNLMAIKSTIDPEDLANIFWSLGKLKYMNEDLTIYL
EAQIYRNSQKFPINCINIVFTSYEKFYRKNLEVLDALSGRYMDLGKHLTYRNLSNLLVSC
SNMNYINSILLEYIEKQLLRRIKASIVEENSDAFEDTGSSILDKYAQQSNTYSHEEMELF
NSIIKLNKPIEGNEQESLVNEQQKNHKEENEASEKLDKDFEDEDNIDEQEDGFEVLEIST
DQKAIQQFQKEFEEQKSYLEVKKKENSEIIENYRIKQHKYDKVDELDPKNATMILLAYCK
MKVVKPELFEVLEANFSNKLDQATPKDVATYSYAHSMLCNELLSQFHESKKRYLKRSLNN
IKKYNHYFYEIVLPFVELNLDKYNCKQLQVIFSSASKPQVKKRAICRQIVSIGLKSIPKL
NDEKFSTEEEKNVFIYKHFKLITNFAYSEDHRRQLILACYDNGIKIDDIYRRYAHILVNN
NIQNISNQEQTDIPLELEPKQQSSWLLQQQDKSQTSSDESVSVSEQDSLSENEEEEQQQS
SNLQKDNQKFTIKSVFDKN


>TTHERM_00922930(gene)
ATGTTTAGTTCACTCCAATTTAAAATAGGTAATCTGCTTAAAGCAATTGGCACTTAAAAA
TAGATTTATAGGTTTGCTAGAGCTACTTAAGGAAAAATAAAGATTTAGAAAGAAAAATTG
GCAGATAAAATTGTTATTGAGAAATAGAAGGAAGCTAGAGAGAATTATATCGAAGAAAAG
AATGAGTTTTCTGCTGAAAACAATATAGCTTAAAATTATATTTTGAATTCAAAAAATCAT
GATAGATTATTTGAAGTATATGAGCATTTTAAAGATTAGATGAATATTATAAATTACTCA
ACTTGTCTCCATTAAGCGATTAAGTTACAAGAAAGTAAAGATTATAGCAATCTCTTAGAT
AAGTATGGACCATAAATTAAAGAAATATGTAATTAATTGGAAACTAATTTATAAAATATG
AAAGGATTCACTGCATCAAATTATTTGTCAAACTTAGTTAAGTTAAAATTATGCACTCCT
CATATTGTAGAAAGTATTTCTAATTTAATTGTAGAAAATAAATGGTAATTTAGTACAAAA
TAGACTTCATTTATACTCTGGTCTATGGCTCACTCAAACATAAAAAACGATAGATATCTT
AAATATGCAGCAACAAATTTAATGGCTATTGTAATATTTTTCAATTTATTTTTATTAATT
CTAAACTTAAACATTGAATTCTCAGTATATTAAATTATTTATTATTGATTATGGAAGGAA
TTAAAGCATCATTTTTAAGGTATTCATAATTCTTATTTATGTAATATAATAGAAAAGTAC
AATTGATCCTGAAGATTTAGCAAATATTTTTTGGAGTTTAGGAAAGCTAAAATATATGAA
TGAAGATTTAACTATATACCTTGAAGCTTAAATTTACAGAAATTCACAAAAGTTTCCAAT
TAACGTAAAAATTTGAGAAATTTATTTATTTACAATAAATAATATCTCTCAGTAGAATTT
GAAATATCTTTTTAAAATTATTTTTTAATTTAGATTAAATTAAGTTTTTTCTATTTTTAT
TATTTAGTGCATTAACATTGTCTTCACAAGTTATGAGAAATTTTATAGAAAAAATCTTGA
AGTTTTAGATGCTTTATCAGGTAGATATATGGACTTAGGAAAGCATTTAACATATAGAAA
TTTATCAAACTTACTTGTAAGTTGCAGTAACATGAACTATATTAACAGCATTTTGTTAGA
ATACATTGAGAAATAGCTCTTGAGAAGAATTAAGGCTAGTATTGTTGAAGAAAATTCTGA
TGCTTTTGAAGATACAGGATCTTCTATTTTAGATAAGTATGCATAATAGTCAAATACCTA
CTCTCATGAAGAGATGGAATTATTTAACAGTATAATAAAACTAAACAAACCAATTGAAGG
TAATGAATAAGAAAGTTTAGTAAACGAATAATAAAAAAATCATAAAGAAGAAAATGAAGC
TTCTGAAAAATTAGATAAAGATTTTGAGGACGAAGATAATATCGATGAGCAAGAAGATGG
ATTTGAAGTTTTAGAAATTTCAACTGATTAAAAAGCTATTTAACAGTTTTAAAAAGAATT
CGAAGAGTAAAAATCTTATTTAGAAGTAAAAAAGAAAGAAAATTCTGAAATAATTGAAAA
TTACCGAATTAAATAGCACAAATATGATAAAGTAGGTAAAATAAATATAAAAAGCTATTG
AATTTCCTATAAATTAACTTTATTGATTAATGAATTTATTTTTTATTAAATATTGTTGTG
ATATATTCATATTTTATACTTTTAAAGATGAGTTAGATCCAAAAAATGCTACTATGATTC
TCTTAGCTTACTGTAAAATGAAAGTAGTAAAACCTGAATTATTTGAGGTACTAGAAGCTA
ATTTTTCAAATAAGCTTGACTAAGCTACTCCTAAAGATGTGGCAACATATAGTTATGCCC
ATTCTATGCTATGCAACGAGCTATTAAGTTAGTTCCATGAATCTAAAAAGAGATATTTAA
AAAGATCGTTAAATAACATAAAGTAAGAAGCAATATATCAATAATAAGAATAATATTTTA
ACCTTATTTTAAAATTAACAGAAAATATAATCATTACTTCTATGAAATTGTTCTTCCATT
TGTAGAATTGAATCTTGATAAGTACAACTGCAAACAACTTCAAGTAATTTTTTCTAGTGC
AAGCAAACCTTAGGTGAAAAAGAGAGCTATTTGCAGATAAATAGTATCTATTGGACTAAA
ATCTATCCCTAAATTGAATGATGAAAAATTCAGCACAGAAGAAGAAAAAAATGTATTTAT
ATATAAGCATTTCAAGCTTATAACAAACTTTGCATATTCAGAAGATCATAGAAGGTATTC
ATTCTATTTTATTTATTATTTTTCAGATTTTTAATGTTTTTTTTTATTATTATTTTTAAA
GATAACTCATTTTGGCTTGCTATGATAATGGCATTAAAATTGATGATATTTATAGAAGAT
ACGCTCATATTCTCGTTAACAATAATATTCAAAATATATCTAATTAAGAATAAACTGATA
TACCTTTAGAATTAGAACCAAAATAATAATCAAGCTGGTTATTATAATAATAAGATAAAA
GCTAAACAAGCTCAGATGAATCAGTTTCTGTGTCAGAGCAGGACAGCTTATCTGAGAATG
AAGAAGAAGAACAATAATAAAGTAGTAATTTATAAAAAGATAATCAAAAATTTACAATAA
AGAGCGTTTTTGATAAAAACTGA