Identifiers and Description

Gene Model Identifier

TTHERM_00780600

Standard Name

MED17 (mediator)

Aliases

PreTt01272 | 130.m00082 | 3738.m00018

Description

transcriptional mediator

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF03789 ) ELK domain
  • ( TIGR02338 ) prefoldin, beta subunit
  • ( TIGR00133 ) glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase, B

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00780600

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_18657.14.0014960278073076e-143hypothetical protein (430 aa)

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:18515835: Bourbon HM (2008) Comparative genomics supports a deep evolutionary origin for the large, four-module transcriptional mediator complex. Nucleic acids research 36(12):3993-4008

Sequences

>TTHERM_00780600(coding)
ATGTCAAAGAAATAGCAGGCAGATATTTTGTAGCCTAAAAAAGTAACAAATCTCAAAGAT
TTAATGAACGTAGGCTATTTTGAGTATGCTTAAAAGGGAGATTCAATATATACTTTAGTG
CCATATGTTACAAATAAATAGCTACATAATTATACTAAAATACTCGAAAAAAACAAAGAT
CCCTAAAATGTTTCTGAGCAAAAATAAAAAATAAAAAACGATATTAAAAGGGAAATAGAA
AATTTACGTAAAGAAATTGGAGGATGCTATGATGTCTTAAAGAATCTTGGTTCATTTTAA
GTAGTTAAAACAGAAAGATTTGATTTACCTGACAATATTAAAGCAAAAGATGTAATTACA
TCTATGCTGATTCGTAAGCAAGAAATATCAGTAACTAGGAAGATGTTTTAGGATGGTTTA
TAATCAATTAGAGAATGTCTAGAATAGCAAGAAAATACAATTAAATAGTAGCAAAAGTAT
AAGCAGTCATTTTACATATCTTAAAGTTCCTAAGTATCTTCTTATAAGCCTTTCCCTTAT
AAAAAAATTGATAATTAGATTTATATAAACTTCTACAACATACCTATCTTTAATGATAAC
CAAATCGCTCCTTTAAATATATCCCCTTATTTACTATTCATCCCTCTTCAATATAAAAAT
GATTAAATAACTGCTAAGTTAGCTGACGTTTACAGAACAACTCCTGATATATTTGAAAAG
CAGTTGATAATAAAGGTTGTTAAAAATAATACTCTAGGTCAAGATCCAGAAAAACTTGGG
CCAACAATCTAATAAATATCGTTTTTATTTAAACCTTAATTAAGTGAAGAGGATGGGGAT
GAAGACGATGAATCTCAGATATAAAAGATATATTAACTAAGATACAGAGTATATGAAAGG
GTTATTTTTAACAAGTTAATAAATATTTGTAACAAATTCGTCCCTAAATAATTATATATC
TACGACACATCAGTCTATCCAAACTTATCTATATTTATTGATGACAGCTATACTCTAAAA
TTTGAGTTGAAAAAGCTGAGCTAGGAAGAAAAACGATTCTATGATAAGAAAAATTCATAC
ATGTCAAGAAAACAACAAGAGGAAAATATAGCAAACTAAATTTCTTATAGCACTACAAGA
TCTCCTTATACACTAAATTTATATAGTAATTTGTTTAATTATATGACAAAGATGCCATCA
CATCGCTCATTGATAAAATATATAATTGAAATTAAGATAACAATTGCTTAGAAATTGTTC
CTTTATTAACCTAGATTTCAAATAAATGTCATAAGAAACTAAAATGAAGAAGTTGTTTAT
ATTGGTGCTCATATTAATAGAACTTCTTCTAAATCGAATTAGGAATAGCAGTATGATACT
TAACTTAAAATTACTCCTTTTACTACAGAATTTTAGCAATTAAATAAATTGAGCTATACT
TTTTCAAATTCTTTAAGCGAAATTCCAAGATTCTGCAAAGAAATGTTATTTGTCTCAGAT
ACTGGTATAATATCTCAGAGAAACCAACTCAGAAATTGGGAATTAGCTTAAATGAATCTA
TAATAATAGATGATGCCAGCATAAACTCCTTAATGA


>TTHERM_00780600(protein)
MSKKQQADILQPKKVTNLKDLMNVGYFEYAQKGDSIYTLVPYVTNKQLHNYTKILEKNKD
PQNVSEQKQKIKNDIKREIENLRKEIGGCYDVLKNLGSFQVVKTERFDLPDNIKAKDVIT
SMLIRKQEISVTRKMFQDGLQSIRECLEQQENTIKQQQKYKQSFYISQSSQVSSYKPFPY
KKIDNQIYINFYNIPIFNDNQIAPLNISPYLLFIPLQYKNDQITAKLADVYRTTPDIFEK
QLIIKVVKNNTLGQDPEKLGPTIQQISFLFKPQLSEEDGDEDDESQIQKIYQLRYRVYER
VIFNKLINICNKFVPKQLYIYDTSVYPNLSIFIDDSYTLKFELKKLSQEEKRFYDKKNSY
MSRKQQEENIANQISYSTTRSPYTLNLYSNLFNYMTKMPSHRSLIKYIIEIKITIAQKLF
LYQPRFQINVIRNQNEEVVYIGAHINRTSSKSNQEQQYDTQLKITPFTTEFQQLNKLSYT
FSNSLSEIPRFCKEMLFVSDTGIISQRNQLRNWELAQMNLQQQMMPAQTPQ


>TTHERM_00780600(gene)
ATGTCAAAGAAATAGCAGGCAGATATTTTGTAGCCTAAAAAAGTAACAAATCTCAAAGAT
TTAATGAACGTAGGCTATTTTGAGTATGCTTAAAAGGGAGATTCAATATATACTTTAGTG
CCATATGTTACAAATAAATAGCTACATAATTATACTAAAATACTCGAAAAAAACAAAGAT
CCCTAAAATGTTTCTGAGCAAAAATAAAAAATAAAAAACGATATTAAAAGGGAAATGTAA
AGAAATCATTTATTTTATTTTCACTTTAGTTAAAGGGTTATAATTTTGTATTTAAGGATG
GATTATGAAAGCTAAAACATAATTTTTTAGCTTTAAATCATTTATTTTTTTACATTTTAA
AGATTATGCAGAATAAATAAGCTGAAAAATTTATGCATTTTATATAATTCAAATTAGAGA
AAATTTACGTAAAGAAATTGGAGGATGCTATGATGTCTTAAAGAATCTTGGTTCATTTTA
AGTAGTTAAAACAGAAAGATTTGATTTACCTGACAATATTAAAGCAAAAGATGTAATTAC
ATCTATGCTGATTCGTAAGCAAGAAATATCAGTAACTAGGAAGATGTTTTAGGATGGTTT
ATAATCAATTAGAGAATGTCTAGAATAGCAAGAAAATACAATTAAATAGTAGCAAAAGTA
TAAGCAGTCATTTTACATATCTTAAAGTTCCTAAGTATCTTCTTATAAGCCTTTCCCTTA
TAAAAAAATTGATAATTAGATTTATATAAACTTCTACAACATACCTATCTTTAATGATAA
CCAAATCGCTCCTTTAAATATATCCCCTTATTTACTATTCATCCCTCTTCAAGTAAGATT
TTTTTTAAATCCTTCATCATTATTGAGAGAAATATAATTAATAACTTTTAAATAAATATA
AATGAATAAAATATTTAAAATTTCTCAATAAAATTATTAGTATAAAAATGATTAAATAAC
TGCTAAGTTAGCTGACGTTTACAGAACAACTCCTGATATATTTGAAAAGCAGTTGATAAT
AAAGGTTGTTAAAAATAATACTCTAGGTCAAGATCCAGAAAAACTTGGGCCAACAATCTA
ATAAATATCGTTTTTATTTAAAGTAATGAATTAAATCTTTTTAACATAAATAACCATAAA
ACTTTAAAAATAAATAGCCTTAATTAAGTGAAGAGGATGGGGATGAAGACGATGAATCTC
AGATATAAAAGATATATTAACTAAGATACAGAGTATATGAAAGGGTTATTTTTAACAAGT
TAATAAATATTTGTAACAAATTCGTCCCTAAATAATTATATATCTACGACACATCAGTCT
ATCCAAACTTATCTGTATAATTAATTACTTCTAAATTTTTTTCTTATTAATAAACAATTA
AAATACTTTAGATATTTATTGATGACAGCTATACTCTAAAATTTGAGTTGAAAAAGCTGA
GCTAGGAAGAAAAACGATTCTATGATAAGAAAAATTCATACATGTCAAGAAAACAACAAG
AGGAAAATATAGCAAACTAAATTTCTTATAGCACTACAAGATCTCCTTATACACTAAATT
TATATAGTGTAAATAAATATTTAGATTTAAAAAATAATATTATAATCACTAATTACTATC
AAATAGAATTTGTTTAATTATATGACAAAGATGCCATCACATCGCTCATTGATAAAATAT
ATAATTGAAATTAAGATAACAATTGCTTAGAAATTGTTCCTTTATTAACCTGTAAATAAA
TAGATTCCAAATAAAATTATTACAACTTTAACATTTAAATTTTTAAAAATCTAGAGATTT
CAAATAAATGTCATAAGAAACTAAAATGAAGAAGTTGTTTATATTGGTGCTCATATTAAT
AGAACTTCTTCTAAATCGAATTAGGAATAGCAGTATGATACTTAACTTAAAATTACTCCT
TTTACTACAGAATTTTAGCAATTAAATAAATGTAAAATTTTCTTTGAATATTCATTTTAA
AATTATTAAATTTGATTCCTTAAAATAAATATCTGAATAACTTTTTATCAAATTTAGTGA
GCTATACTTTTTCAAATTCTTTAAGCGAAATTCCAAGATTCTGCAAAGAAATGTTATTTG
TCTCAGATACTGGTATAATATCTCAGAGAAACCAACTCAGAAATTGGGAATTAGCTTAAA
TGAATCTATAATAATAGATGATGCCAGCATAAACTCCTTAATGA