Identifiers and Description

Gene Model Identifier

TTHERM_00918460

Standard Name

MED11 (Mediator subunit 11)

Aliases

PreTt07041 | 163.m00043 | 3754.m00249

Description

Subunit 11 of transcriptional regulator Mediator complex. Co-purified with Med31 in AP-MS experiments.

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 9.9%

TetraMine Data

TTHERM_00918460

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Stentor CoeruleusSteCoe_205690
Tetrahymena borealisEI9_19171.13.0011931572567413e-53hypothetical protein (138 aa)

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:31280994: Garg J, Saettone A, Nabeel-Shah S, Cadorin M, Ponce M, Marquez S, Pu S, Greenblatt J, Lambert JP, Pearlman RE, Fillingham J (2019) The Med31 Conserved Component of the Divergent Mediator Complex in Tetrahymena thermophila Participates in Developmental Regulation. Current biology : CB ( ):

Sequences

>TTHERM_00918460(coding)
ATGGATGTTTAGGAGAATTTAAGCTAGAATTAGCAGGTCAATTACTTTAAGAGTAAATTG
ACTGATTTAAAATAATTTAAGAAATAACTTGAAGAAGCATACAATGATAAAAGTACAACC
TACCTATAAAAGAATGATAAATTCTTTGCAATTATAAACGATTACAAGCAATAACTTGAA
GATATATAAAAAATAATAGAAGAAGATATAGTTAATGTGAATGCTCCTAACATACCTGAA
GAGCTAATTAAACGCTAAGATTAAGATTAAAGTATTAAGGAGTATATGTAAGAAAGAAAA
GAATTAGTAAAGAAAAGTATAGATGGATAAAAAGAAAAACTATAGTTTATTTAAAATTTT
ACAAATGAATTTGAGAAGAGTTTAAAAGAGTATAAAATTTTACCTGATTCTTGA


>TTHERM_00918460(protein)
MDVQENLSQNQQVNYFKSKLTDLKQFKKQLEEAYNDKSTTYLQKNDKFFAIINDYKQQLE
DIQKIIEEDIVNVNAPNIPEELIKRQDQDQSIKEYMQERKELVKKSIDGQKEKLQFIQNF
TNEFEKSLKEYKILPDS


>TTHERM_00918460(gene)
ATGGATGTTTAGGAGAATTTAAGCTAGAATTAGCAGGTCAATTACTTTAAGAGTAAATTG
ACTGATTTAAAATAATTTAAGAAATAACTTGAAGAAGCATACAATGATAAAAGTACAACC
TACCTATAAAAGAATGATAAATTCTTTGCAATTATGTATGTTGAAGCATATTTAATTATA
ATAATTAGAGATTTATTTTTTATAAAAAATAAGAAACGATTACAAGCAATAACTTGAAGA
TATATAAAAAATAATAGAAGAAGATATAGTTAATGTGAATGCTCCTAACATACCTGAAGA
GCTAATTAAGTAATTAAATTTATTTTATTTGGATAAAATAAACAAATAATCTTTAATACT
AATAGACGCTAAGATTAAGATTAAAGTATTAAGGAGTATATGTAAGAAAGAAAAGAATTA
GTAAAGAAAAGTATAGATGGATAAAAAGAAAAACTATAGTTTATTTAAAATTTTACAAAT
GAATTTGAGAAGAGTTTAAAAGAGTATAAAATTTTACCTGATTCTTGA