Identifiers and Description

Gene Model Identifier

TTHERM_00355780

Standard Name

MEC17 (homolog of a C. elegans MEChanosensory protein)

Aliases

PreTt27564 | 37.m00281 | 3836.m02370

Description

alpha-tubulin acetyltransferase

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF05301 ) Protein of unknown function (DUF738)

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00355780

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_02254.19.997093137033517e-262alpha-tubulin N-acetyltransfer
ase (401 aa)
OxytrichaContig16083.0.g1018.996537154595168e-51Touch receptor neuron protein
Mec-17
WormBaseWBGene000031783.99801309251602e-27locus:mec-17 status:Confirme
d UniProt:O45100 protein_i
d:CCD69773.1
Stentor CoeruleusSteCoe_142002.6102790696677047e-23

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00355780(coding)
ATGGAGTTTAATTTCATCATTAATAAGTTAGTTTAATTGGACTAGTAAGGCCTTGGTGTA
TATATACCAAGGGCTAGTAGAAGCAAAGTTAGCAGTTAGCAAGAATAGTAGTTAGGATAA
GTTTTAAATACGATGGGTGAAAGATCAGCGATAGCCTAGGGATTAAAGCAAGTAATAACA
AATTACGATAAGGTATAAGGAACAGACTAAAGAGTTTACATAGTGGCAGAAGGTAGAACT
TGCTAGGGATTTCTTAAAGTTGGATAAAAGAATCTTTTTTATCGAGATATGATGGGAAAT
ATTAAAGAAATTAAGCCACTATGTGTGCTTGACTTTTATGTACATGAATCTTGCCAGAGA
TAAGGATATGGAAAACTACTTTTTGAGTACATGATTTAATGCGAATAAACCTCACCAGAA
AAATTAGCATATGATCGTCCTTCTCCCAAGCTGATAGCCTTCCTTAAAAAGCATTATAAT
TTAGTCAAATACATAGCACAAAATAACAATTTTGTTGTTTTTGATTAGTACTTTAGAAGT
GATGCTTCTAGTTAAAACAAATAAAATTAAAATACTCGTTCTTATTCTTAGCCTTACAGT
GATTATTCTTCGCAAATTCCTACTAATTATCCTTAACAGCAGCAATAACAGTCTAATAGT
AAATCTTATCCTTATAAACAAGAAAATAATATCGATTTAATGCAACACTCTTCATCTAGA
AACAACAAAGAATTCTTGAATGCAGGCAGAGCTATACTATCAAAAGAAGAAATTTATAAA
AAAGATAACTTAAGTCAGTAGAATATAGAAAATACCTTAAATAATATTAATAATTCCTAA
TATTCAACAAAAAGCCAACAATAGCAGTAATATTAAAAAGACTACTAGTTAGATAAGTAT
GAGAATAATTGGGGAGCTGACAAAAATATCAAAAAGCCTCCCTTCCCTGGATAAGATAGA
TAACTTGATAAAATATAGTAAAAAATATAGTAAACTGAAAGAGAGCTTGATGTCGTTAAT
TAACAAATTATTAAGCAAAGGCAAAACCTCTCTCAAGACCCATTAACATAAAACCATAGA
GCATAAAATGTTTATAACACAAATTAGTTTGGAACTTCTCCATGGGCTCAGACAGGATTT
AATTATTATTCAACATCATCTTCTAACTATGGAAATCACTACACATACTACAAAAAATGA


>TTHERM_00355780(protein)
MEFNFIINKLVQLDQQGLGVYIPRASRSKVSSQQEQQLGQVLNTMGERSAIAQGLKQVIT
NYDKVQGTDQRVYIVAEGRTCQGFLKVGQKNLFYRDMMGNIKEIKPLCVLDFYVHESCQR
QGYGKLLFEYMIQCEQTSPEKLAYDRPSPKLIAFLKKHYNLVKYIAQNNNFVVFDQYFRS
DASSQNKQNQNTRSYSQPYSDYSSQIPTNYPQQQQQQSNSKSYPYKQENNIDLMQHSSSR
NNKEFLNAGRAILSKEEIYKKDNLSQQNIENTLNNINNSQYSTKSQQQQQYQKDYQLDKY
ENNWGADKNIKKPPFPGQDRQLDKIQQKIQQTERELDVVNQQIIKQRQNLSQDPLTQNHR
AQNVYNTNQFGTSPWAQTGFNYYSTSSSNYGNHYTYYKK


>TTHERM_00355780(gene)
AATCAATTACTGTTTAAAACATAATCTATAGATTAAATATTACAATATCTTTAACAAAAG
AAAAAAACCCACTAATCGATTTTAGAAAATTAAAATCAGCACATACATTCAATTGGTTTA
GTTAGTTAGTTAACAAACTAAAAAATAAATAAACAAAAAAATTAAAAAGCAATGGAGTTT
AATTTCATCATTAATAAGTTAGTTTAATTGGACTAGTAAGGCCTTGGTGTATATATACCA
AGGGCTAGTAGAAGCAAAGTTAGCAGTTAGCAAGAATAGTAGTTAGGATAAGTTTTAAAT
ACGATGGGTGAAAGATCAGCGATAGTAAGTATTAAGTCAAATACGACAAATAAAGATAGA
AATTTTACAATTAATAATAGGCCTAGGGATTAAAGCAAGTAATAACAAATTACGATAAGG
TATAAGGAACAGACTAAAGAGTTTACATAGTGGCAGAAGGTAGAACTTGCTAGGGATTTC
TTAAAGTTGGATAAAAGAATCTTTTTTATCGAGATATGATGGGAAATATTAAAGAAATTA
AGCCACTATGTGTGCTTGACTTTTATGTACATGAATCTTGCCAGAGATAAGGATATGGAA
AAGTATTTTATTTTTATTTTATACAAAAAGCAGAGAAATTCATTAATTTAAATTAAATTT
TAATATGAATGTAGCTACTTTTTGAGTACATGATTTAATGCGAATAAACCTCACCAGAAA
AATTAGCATATGATCGTCCTTCTCCCAAGCTGATAGCCTTCCTTAAAAAGCATTATAATT
TAGTCAAATACATAGCACAAAATAACAATTTTGTTGTTTTTGATTAGTACTTTAGAAGTG
ATGCTTCTAGTTAAAACAAATAAAATTAAAATACTCGTTCTTATTCTTAGCCTTACAGTG
ATTATTCTTCGCAAATTCCTACTAATTATCCTTAACAGCAGCAATAACAGTCTAATAGTA
AATCTTATCCTTATAAACAAGAAAATAATATCGATTTAATGCAACACTCTTCATCTAGAA
ACAACGTAAAAAATATTTATAAAATAGATGAACAATTTTATATTTATTTTCAAGCACTAC
TTATTAAACATGATTAATTTTTATAAAAATACTATTTAATTTAAATAGAAAGAATTCTTG
AATGCAGGCAGAGCTATACTATCAAAAGAAGAAATTTATAAAAAAGATAACTTAAGTCAG
TAGAATATAGAAAATACCTTAAATAATATTAATAATTCCTAATATTCAACAAAAAGCCAA
CAATAGCAGTAATATTAAAAAGACTACTAGTTAGATAAGTATGAGAATAATTGGGGAGCT
GACAAAAATATCAAAAAGCCTCCCTTCCCTGGATAAGATAGATAACTTGATAAAATATAG
TAAAATTAATTTATTAGTTTCAATAATTAAAACAAATATTTAGGTAAAAAATATAGTAAA
CTGAAAGAGAGCTTGATGTCGTTAATTAACAAATTATTAAGTAAAAAGTTTAATTATTTT
TTGTTATTCAAAAATTATAATTACATTATTTAATAGGCAAAGGCAAAACCTCTCTCAAGA
CCCATTAACATAAAACCATAGAGCATAAAATGTTTATAACACAAATTAGTTTGGAACTTC
TCCATGGGCTCAGACAGGATTTAATGTAAGAAATTAAAATAAAAATAAAAATATTAAATT
ATTTTTAATAAAAAATAAATAGTATTATTCAACATCATCTTCTAACTATGGAAATCACTA
CACATACTACAAAAAATGA