Identifiers and Description

Gene Model Identifier

TTHERM_01151610

Standard Name

MDLG1 (Mitofilin-Domain Like Gene 1)

Aliases

PreTt20201 | 256.m00034 | 3826.m00081

Description

Normocyte binding protein 2a-related

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.1%

TetraMine Data

TTHERM_01151610

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_20739.14.9978542490096724e-147normocyte binding protein 2a (
250 aa)
OxytrichaContig1313.1.g990.00000000000009996062864481225SF-assemblin/beta giardin

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:SUPR000351

Sequences

>TTHERM_01151610(coding)
ATGAATAGTCTTTATTAAGAGAGAGTTACAAAAGTATTTGACAGACTTTAAAACATTTAA
ACCAACGTAGATTCTGAAAGATAAACAAAATGGAAATTCGCTTTATCCATTATTGAGAAT
TTAGAAAGAAAAGTTGATGAAATATATACTTCTAAAGTGGACAAGTTTGAAGCATTAAAT
GATAAAATTAAAGCTCTTTTTGATCATCTTCACCAACAAAAAACGATATAAGTGAGACTT
GACACAGAAGTTTAAGAAAATATTGAATAAACTAAAAAAAATTGCGTTAACCTTCTAGAT
AGTTTCACAAAGGAAAGAGAAGATAGTGAAAGAAGAGTATACTAGAAATTGAATACTTAA
ATAGACAATTTAACTATCGAAATTTAAAGAAATTACTAAGAGAGAACAGCTTCTTAAAAC
TATTTATAAAGCTAACTTGAAGATGAGCTTCCTCGTTTTGAATAAGAAATTAAATAAGAG
AGCTAATTTAGATAGGATTTAGAATAAAGAATCTATTAATAATTTAGTGAGTAAATTTCA
GAGTTAAAAGAAATGTTCGAAGTTGAAAGAAAAGAACGTGAATAACGTGAAGAAGAATTA
ATTAATATCCTTAAAGTAATCTATACTAAAGTAAATGAAGCTATTGCAAGATGCAAAAGT
GACAGAGAAAAAAGTGAAGAAATGTTAGTCAGACTTGTCGAATAAGTAATTGAAAAAATC
AAAAAGGAATTAAGCGAGTCAGATTATTGA


>TTHERM_01151610(protein)
MNSLYQERVTKVFDRLQNIQTNVDSERQTKWKFALSIIENLERKVDEIYTSKVDKFEALN
DKIKALFDHLHQQKTIQVRLDTEVQENIEQTKKNCVNLLDSFTKEREDSERRVYQKLNTQ
IDNLTIEIQRNYQERTASQNYLQSQLEDELPRFEQEIKQESQFRQDLEQRIYQQFSEQIS
ELKEMFEVERKEREQREEELINILKVIYTKVNEAIARCKSDREKSEEMLVRLVEQVIEKI
KKELSESDY


>TTHERM_01151610(gene)
ATGAATAGTAATGATTTGAATGGCTGGCTTGTTCAGATATTTACCCTTTATTTATTAATT
AGGTCTTTATTAAGAGAGAGTTACAAAAGTATTTGACAGACTTTAAAACATTTAAGTAAT
GATATTTAAAAGTTCAGAAAATAAATAAATAAATTATTAATACTAAAAATTCTTAATATG
GTATTATAAATCCAATTTATTTACTTATTCATTTAAATCAAAAGACCAACGTAGATTCTG
AAAGATAAACAAAATGGAAATTCGCTTTATCCATTATTGAGAATTTAGAAAGAAAAGTTG
ATGAAATATATACTTCTAAAGTGGACAAGTTTGAAGCATTAAATGATAAAGTAATTCTAT
ATTTGATGAATATATTTTAATAAAATTTAAGGCACATACAAATATAATAACAATTTAAAT
GCTATATTTTGTATTTAAGAATAGACTATGTCAAAATTTAAAATGCTTTAAAATAATTTA
TTTATTTATTTTAAATTTTATTAAGATTAAAGCTCTTTTTGATCATCTTCACCAACAAAA
AACGATATAAGTGAGACTTGACACAGAAGTTTAAGAAAATATTGAATAAACTAAAAAAAA
TTGCGTTAACCTTCTAGATAGTTTCACAAAGGTAAATATTAAAATATATCTTTTTTTAAG
ATGGAAATTATTGGTTTTAAAAATTAGTTTGTTTTTAAAATTATTAATTTATATGATAAG
ATATGTAGAAAATGCTAATTAAATAATTTTTATTTCTATTTATAATTTTTTAATTGAAAA
GGAAAGAGAAGATAGTGAAAGAAGAGTATACTAGAAATTGAATACTTAAATAGACAATTT
AACTATCGAAATTTAAAGAAATTACTAAGAGAGAACAGCTTCTTAAAACTATTTATAAAG
CTAACTTGAAGATGAGCTTCCTCGTTTTGAATAAGAAATTAAATAAGAGAGCTAATTTAG
ATAGGATTTAGAATAAAGAATCTATTAATAATTTAGTGAGTAAATTTCAGAGTTAAAAGA
AATGTTCGAAGTTGAAAGAAAAGAACGTGAATAACGTGAAGAAGAATTAATTAATATCCT
TAAAGTAATCTATACTAAAGTAAATGAAGCTATTGCAAGATGCAAAAGTGACAGGTAATT
TATTAATTAACTGATGATATTAATTTCAAATTAATTTTTTCTTAAATTATGATTGATAAC
AGAGAAAAAAGTGAAGAAATGTTAGTCAGACTTGTCGAATAAGTAATTGAAAAAATCAAA
AAGGAATTAAGCGAGTCAGATTATTGA